LXL04_008734 | RubberDandelionOmics

Gene overview

LXL04_008734

Reference: OH-1004 Chr: Chr02 Coordinates: 107503406-107505980 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

801 bp · LXL04_008734|LXL04_008734|OH1004|cDNA

ATGATTAAGGCTCATCTGATTTTAAGTCAGACACGCCTGATTTTTAGTAGATTGGCTGATTTTTCATCTGTTTTGACTGAGTTTAACTCTATTTGGTCTAATTTCTGGTCGGATTCCGACCCAAACCCGATCCAAACCCGACCCGCTCCACGACCCGGGtatataagaaataaaaacctAAAATTCCATTTCACCCCAAAACCGGCCGCGAAAGAGTTTGGCTCTCTCACTGGGCGATTTCCGGCGACTCCTCCGGCGAC...

CDS

Download CDS FASTA

801 bp · LXL04_008734|LXL04_008734|OH1004|CDS

ATGATTAAGGCTCATCTGATTTTAAGTCAGACACGCCTGATTTTTAGTAGATTGGCTGATTTTTCATCTGTTTTGACTGAGTTTAACTCTATTTGGTCTAATTTCTGGTCGGATTCCGACCCAAACCCGATCCAAACCCGACCCGCTCCACGACCCGGGTATATAAGAAATAAAAACCTAAAATTCCATTTCACCCCAAAACCGGCCGCGAAAGAGTTTGGCTCTCTCACTGGGCGATTTCCGGCGACTCCTCCGGCGAC...

Protein

Download Protein FASTA

266 aa · LXL04_008734|LXL04_008734|OH1004|PROTEIN

MIKAHLILSQTRLIFSRLADFSSVLTEFNSIWSNFWSDSDPNPIQTRPAPRPGYIRNKNLKFHFTPKPAAKEFGSLTGRFPATPPATCSSSPAHCTSSDDPPLTRDSSNERISPPISPLLTDSFLSSNFDYFLNVVRLGGLVKAGLDVAQIWLDGDETLVNTIDRDGNMLPINMTNGHALTRDPLVVLYHIEPSADSEYIHIRIQQRNGRKSLTIVYERAQLRENSQRSEEGILLDPIDQRKNVSAFLTRVGIVKKDQIK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008734`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008734

Location Chr02:107503406-107505980 (+)

Description Similar to CTPA3: Carboxyl-terminal-processing peptidase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57680`	Protease involved in the C-terminal processing of the chloroplastic D1 protein of photosystem II.	No verified direct reference in this release
`At1g54290`	Probably involved in translation.	No verified direct reference in this release
`At4g27130`	Probably involved in translation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008734 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006417 regulation of translation Biological Process

GO:0006508 proteolysis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0003743 translation initiation factor activity Molecular Function

GO:0004175 endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G54290

ath:AT3G57680

ath:AT4G27130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.471

Rank 1 · LXL04_008734 · OH-1004

Cytoplasm0.427

Rank 2 · LXL04_008734 · OH-1004

Mitochondrion0.123

Rank 3 · LXL04_008734 · OH-1004

Cell membrane0.063

Rank 4 · LXL04_008734 · OH-1004

Endoplasmic reticulum0.050

Rank 5 · LXL04_008734 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J3G5`	Arabidopsis thaliana	Carboxyl-terminal-processing peptidase 3, chloroplastic	64.000%	Swiss-Prot	weak database homology
`Q94JV4`	Arabidopsis thaliana	Protein translation factor SUI1 homolog 2	44.828%	Swiss-Prot	weak database homology
`P41568`	Arabidopsis thaliana	Protein translation factor SUI1 homolog 1	44.828%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card