LXL04_008713 | RubberDandelionOmics

Gene overview

LXL04_008713

Reference: OH-1004 Chr: Chr02 Coordinates: 106621110-106623739 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1653 bp · LXL04_008713|LXL04_008713|OH1004|cDNA

ATGATGAGGTGGGAGAAATTGGAGATACAAAGAGGAGGGCCGGGGAAGAGATGGGGCCATACGTGCAACGCGGTTCGTGGTGGTCAGCTGCTCTACATCTTCGGTGGTTACGGCGAAGACAACGCCCAGACTAATAAAGTTCACGTCTACGACACCACTGCAAGGACATGGAGTGAACCTGATATGCAAGGCACACTACCTGTTCCCAGAGACAGCCACAGCTGCACCACTGTAGGAGACAAGTTGTTTGTATTTGGTGG...

CDS

Download CDS FASTA

1653 bp · LXL04_008713|LXL04_008713|OH1004|CDS

ATGATGAGGTGGGAGAAATTGGAGATACAAAGAGGAGGGCCGGGGAAGAGATGGGGCCATACGTGCAACGCGGTTCGTGGTGGTCAGCTGCTCTACATCTTCGGTGGTTACGGCGAAGACAACGCCCAGACTAATAAAGTTCACGTCTACGACACCACTGCAAGGACATGGAGTGAACCTGATATGCAAGGCACACTACCTGTTCCCAGAGACAGCCACAGCTGCACCACTGTAGGAGACAAGTTGTTTGTATTTGGTGG...

Protein

Download Protein FASTA

550 aa · LXL04_008713|LXL04_008713|OH1004|PROTEIN

MMRWEKLEIQRGGPGKRWGHTCNAVRGGQLLYIFGGYGEDNAQTNKVHVYDTTARTWSEPDMQGTLPVPRDSHSCTTVGDKLFVFGGTDGNIPLKDLHILDTTTNTWMTPYVRGEGPEPREGHSAALIGKRLFIFGGCGKSFDTPVEEYFDDLYILNTETMVWKRVATTGIPPAKRNSHTCVSWKNKIIVIGGEDTQNYYMSDVQMLDTDTLSWTKLVTNGELLPPRAGHTTIALGKNLFVFGGFTDAEDLYDDLYMFDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008713`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_008713`
Location	Chr02:106621110-106623739 (-)
Description	Similar to Klhdc3: Kelch domain-containing protein 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008713` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0016567 protein ubiquitination Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0140627 ubiquitin-dependent protein catabolic process via the C-end degron rule pathway Biological Process GO:0000785 chromatin Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0031462 Cul2-RING ubiquitin ligase complex Cellular Component GO:0003682 chromatin binding Molecular Function GO:1990756 ubiquitin-like ligase-substrate adaptor activity Molecular Function
KEGG gene cross-reference	mmu:71765 rno:363192 xla:447194 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.526

Rank 1 · LXL04_008713 · OH-1004

Cytoplasm0.452

Rank 2 · LXL04_008713 · OH-1004

Cell membrane0.092

Rank 3 · LXL04_008713 · OH-1004

Endoplasmic reticulum0.057

Rank 4 · LXL04_008713 · OH-1004

Lysosome / Vacuole0.048

Rank 5 · LXL04_008713 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24681.2Kelch_KLHDC2_KLHL20_DRC72-193 aa

PF24981.2Beta-prop_ATRN-LZTR13-80 aa

PF13854.13Kelch_HCF3-246 aa

PF13415.13Beta-prop_FBX424-107 aa

PF24996.1NANM21-92 aa

PF01344.32Kelch_122-59 aa

PF07646.22Kelch_222-59 aa

PF24981.2Beta-prop_ATRN-LZTR131-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008713	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	2	193	6.5e-102	340.2
LXL04_008713	`PF24981.2`	Beta-prop_ATRN-LZTR1	3	80	4.1e-56	191.1
LXL04_008713	`PF13854.13`	Kelch_HCF	3	246	1.9e-38	133.4
LXL04_008713	`PF13415.13`	Beta-prop_FBX42	4	107	1.3e-66	224.9
LXL04_008713	`PF24996.1`	NANM	21	92	3.8e-23	82.6
LXL04_008713	`PF01344.32`	Kelch_1	22	59	6.8e-46	154.1
LXL04_008713	`PF07646.22`	Kelch_2	22	59	1.3e-31	107.6
LXL04_008713	`PF24981.2`	Beta-prop_ATRN-LZTR1	31	108	4.1e-56	191.1
LXL04_008713	`PF25210.2`	Kelch_FKB95	67	167	6e-19	69.4
LXL04_008713	`PF01344.32`	Kelch_1	69	108	6.8e-46	154.1
LXL04_008713	`PF07646.22`	Kelch_2	69	107	1.3e-31	107.6
LXL04_008713	`PF24981.2`	Beta-prop_ATRN-LZTR1	82	304	4.1e-56	191.1
LXL04_008713	`PF24996.1`	NANM	116	218	3.8e-23	82.6
LXL04_008713	`PF01344.32`	Kelch_1	119	168	6.8e-46	154.1
LXL04_008713	`PF07646.22`	Kelch_2	119	167	1.3e-31	107.6
LXL04_008713	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	122	313	6.5e-102	340.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card