Gene Card
Gene overview
cDNA / CDS / Protein Sequences
912 bp · LXL04_008694|LXL04_008694|OH1004|cDNA
ATGGTGAGGGATCAAGACCATTACTTCCCTCCAGTTGGAAGCATTCCCGCCATAACCGACATCCATCATAATGGCACATCATCATCACCATCGTCTCCGTCTACTCAGTATAGATGCCATGGATTATGGTACACCGCCACTTTATCGATCCCGTCGGTATTATTTGTACTCTATCTAGGGTTTCATCTCAAAAGAAACATCAAGAAGCTCAATCGCCGTAGGTCGCATGTTATGATTGCTTATTATGCTCTCCTATGGCT...
912 bp · LXL04_008694|LXL04_008694|OH1004|CDS
ATGGTGAGGGATCAAGACCATTACTTCCCTCCAGTTGGAAGCATTCCCGCCATAACCGACATCCATCATAATGGCACATCATCATCACCATCGTCTCCGTCTACTCAGTATAGATGCCATGGATTATGGTACACCGCCACTTTATCGATCCCGTCGGTATTATTTGTACTCTATCTAGGGTTTCATCTCAAAAGAAACATCAAGAAGCTCAATCGCCGTAGGTCGCATGTTATGATTGCTTATTATGCTCTCCTATGGCT...
Protein
Download Protein FASTA303 aa · LXL04_008694|LXL04_008694|OH1004|PROTEIN
MVRDQDHYFPPVGSIPAITDIHHNGTSSSPSSPSTQYRCHGLWYTATLSIPSVLFVLYLGFHLKRNIKKLNRRRSHVMIAYYALLWLSAILNLAWCALQAWQCIPGKEVSWNLLSLMTSMGTLCLEISLVAFLLQENYASGLEALAHTFMVSGLVVGADILLKAIFVFGFRVPLFMDDETRHQGKWGLWIFDELLLTCSYAYILFVHYSKWRDKLPPRPAFYNYVVVMFIITGIALSGCGLAAAGLGFGLWVYSFVVVCY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_008694 |
|---|---|
| TK1151 ID | TkA03G344410 |
| OH-1004 ID | LXL04_008694 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_008694 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:106382888-106384500 (+) | |||||||||
| Description | Similar to CAND2: Protein CANDIDATE G-PROTEIN COUPLED RECEPTOR 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002237 response to molecule of bacterial origin Biological Process GO:0006970 response to osmotic stress Biological Process GO:0007186 G protein-coupled receptor signaling pathway Biological Process GO:0010015 root morphogenesis Biological Process GO:0010555 response to mannitol Biological Process GO:0019236 response to pheromone Biological Process GO:0090333 regulation of stomatal closure Biological Process GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0004930 G protein-coupled receptor activity Molecular Function GO:0008502 melatonin receptor activity Molecular Function GO:1904408 melatonin binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G05010 ath:AT5G27210 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF10160.16Tmemb_4038-290 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_008694 | PF10160.16 | Tmemb_40 | 38 | 290 | 1.2e-102 | 343.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.