LXL04_008657 | RubberDandelionOmics

Gene overview

LXL04_008657

Reference: OH-1004 Chr: Chr02 Coordinates: 105392878-105394074 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1020 bp · LXL04_008657|LXL04_008657|OH1004|cDNA

ATGGAGAAGCTCTCGGAGGCTGGTCAAGACGATGATCAAATGGATATGCCTCCAGGATTCCGATTTCATCCGACAGATGAAGAATTGATCACTCATTATCTGTCAAACAAAGTTGTCGATAGCAACTTCTTTGCAAAAGCAATCGGAGAGGTCGACATGAACAGAATCGAGCCATGGGAATTACCTAGGAAGGCAAAAATGGGAGAAAAAGAATGGTACTTTTTCTGTTTTAGGGATAAGAAGTACCCCACCGGATTACG...

CDS

Download CDS FASTA

1020 bp · LXL04_008657|LXL04_008657|OH1004|CDS

ATGGAGAAGCTCTCGGAGGCTGGTCAAGACGATGATCAAATGGATATGCCTCCAGGATTCCGATTTCATCCGACAGATGAAGAATTGATCACTCATTATCTGTCAAACAAAGTTGTCGATAGCAACTTCTTTGCAAAAGCAATCGGAGAGGTCGACATGAACAGAATCGAGCCATGGGAATTACCTAGGAAGGCAAAAATGGGAGAAAAAGAATGGTACTTTTTCTGTTTTAGGGATAAGAAGTACCCCACCGGATTACG...

Protein

Download Protein FASTA

339 aa · LXL04_008657|LXL04_008657|OH1004|PROTEIN

MEKLSEAGQDDDQMDMPPGFRFHPTDEELITHYLSNKVVDSNFFAKAIGEVDMNRIEPWELPRKAKMGEKEWYFFCFRDKKYPTGLRTNRATAAGYWKATGKDKEIYRGRLVVGMKKTLVFYMGRAPKGEKTNWVIHEYRLDGKFSLQSLPKSAKNEWVICRVFHKNSGGKKVPVSGLMRIDSSGVDRSLPPLIDSPAAIGGRIINPIISNSLHVPCFSNLSDVQTTQKNMINNFLNSSIFPFDPSSIPVLEGQSDPLTH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008657`
TK1151 ID	TkA03G348440
OH-1004 ID	LXL04_008657
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008657

Location Chr02:105392878-105394074 (+)

Description Similar to NAC079: NAC domain-containing protein 79

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07680`	NAC domain-containing protein 79.	No verified direct reference in this release
`At5g61430`	Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO.	No verified direct reference in this release
`At5g39610`	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3'.	The delayed leaf senescence mutants of Arabidopsis, ore1, ore3, and ore9 are tolerant to oxidative stress.2004 · DOI: 10.1093/pcp/pch110 Trifurcate feed-forward regulation of age-dependent cell death involving miR164 in Arabidopsis.2009 · DOI: 10.1126/science.1166386 Forward and reverse genetics to identify genes involved in the age-related resistance response in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1364-3703.2009.00557.x A gene regulatory network controlled by the NAC transcription factor ANAC092/AtNAC2/ORE1 during salt-promoted senescence.2010 · DOI: 10.1111/j.1365-313x.2010.04151.x ORS1, an H₂O₂-responsive NAC transcription factor, controls senescence in Arabidopsis thaliana.2011 · DOI: 10.1093/mp/ssq080 NAC transcription factor ORE1 and senescence-induced BIFUNCTIONAL NUCLEASE1 (BFN1) constitute a regulatory cascade in Arabidopsis.2013 · DOI: 10.1093/mp/sst012 ORE1 balances leaf senescence against maintenance by antagonizing G2-like-mediated transcription.2013 · DOI: 10.1038/embor.2013.24
`At3g29035`	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4- 5n)[AG][CT]ACGCAA-3'.	ORS1, an H₂O₂-responsive NAC transcription factor, controls senescence in Arabidopsis thaliana.2011 · DOI: 10.1093/mp/ssq080
`At3g04060`	Transcriptional activator that acts as a positive regulator of leaf senescence.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008657 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

KEGG gene cross-reference

ath:AT3G04060

ath:AT3G29035

ath:AT5G07680

ath:AT5G39610

ath:AT5G61430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.968

Rank 1 · LXL04_008657 · OH-1004

Cytoplasm0.084

Rank 2 · LXL04_008657 · OH-1004

Cell membrane0.034

Rank 3 · LXL04_008657 · OH-1004

Endoplasmic reticulum0.023

Rank 4 · LXL04_008657 · OH-1004

Plastid0.015

Rank 5 · LXL04_008657 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365.21NAM17-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008657	`PF02365.21`	NAM	17	141	3.8e-48	163.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLR3`	Arabidopsis thaliana	NAC domain-containing protein 79	58.982%	Swiss-Prot	strong database homology
`Q9FLJ2`	Arabidopsis thaliana	NAC domain-containing protein 100	55.587%	Swiss-Prot	strong database homology
`Q9FKA0`	Arabidopsis thaliana	NAC domain-containing protein 92	58.635%	Swiss-Prot	strong database homology
`Q9LJW3`	Arabidopsis thaliana	NAC domain-containing protein 59	47.353%	Swiss-Prot	moderate database homology
`Q9SQQ6`	Arabidopsis thaliana	NAC domain-containing protein 46	65.347%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card