LXL04_008642 | RubberDandelionOmics

Gene overview

LXL04_008642

Reference: OH-1004 Chr: Chr02 Coordinates: 104983644-104984909 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

960 bp · LXL04_008642|LXL04_008642|OH1004|cDNA

ATGGGAAGACCACCTTGCTGCGATAAGATAGGTGTGAAAAAAGGGCCATGGACTCCAGAAGAGGACATAATTCTCGTATCTTTTATTCAACAAAATGGTCCGGGCAATTGGAGATCTGTTCCTACCAATACTGGTTTGCTAAGATGTAGCAAGAGTTGTAGACTACGTTGGACCAATTATCTTCGGCCTGGTATCAAACGTGGCAACTTCACGGAGCAAGAGGAGAAGATGATTATCCATCTTCAAGCGCTTCTCGGCAA...

CDS

Download CDS FASTA

960 bp · LXL04_008642|LXL04_008642|OH1004|CDS

ATGGGAAGACCACCTTGCTGCGATAAGATAGGTGTGAAAAAAGGGCCATGGACTCCAGAAGAGGACATAATTCTCGTATCTTTTATTCAACAAAATGGTCCGGGCAATTGGAGATCTGTTCCTACCAATACTGGTTTGCTAAGATGTAGCAAGAGTTGTAGACTACGTTGGACCAATTATCTTCGGCCTGGTATCAAACGTGGCAACTTCACGGAGCAAGAGGAGAAGATGATTATCCATCTTCAAGCGCTTCTCGGCAA...

Protein

Download Protein FASTA

319 aa · LXL04_008642|LXL04_008642|OH1004|PROTEIN

MGRPPCCDKIGVKKGPWTPEEDIILVSFIQQNGPGNWRSVPTNTGLLRCSKSCRLRWTNYLRPGIKRGNFTEQEEKMIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKLEKLHEESDQETHHHHQATSKGCHSSSLSETTMYKGQWERRLQTDIHMAKQALCEALSLDNKSINLPLLSSNMNSSDKLQSVLPLSNQSTTTYASSAENIARLLPDWMKCSKKSPEINPSPPSEGYDNSVQIGYNNNMNYYSNYS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008642`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008642

Location Chr02:104983644-104984909 (-)

Description Similar to MYB306: Myb-related protein 306

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62470`	Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress.	The MYB96 transcription factor mediates abscisic acid signaling during drought stress response in Arabidopsis.2009 · DOI: 10.1104/pp.109.144220 MYB96-mediated abscisic acid signals induce pathogen resistance response by promoting salicylic acid biosynthesis in Arabidopsis.2010 · DOI: 10.1111/j.1469-8137.2010.03183.x The MYB96 transcription factor regulates cuticular wax biosynthesis under drought conditions in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083485 Lipid transfer protein 3 as a target of MYB96 mediates freezing and drought stress in Arabidopsis.2013 · DOI: 10.1093/jxb/ert040 The Arabidopsis MYB96 transcription factor plays a role in seed dormancy.2015 · DOI: 10.1007/s11103-015-0283-4 The Arabidopsis MYB96 Transcription Factor Is a Positive Regulator of ABSCISIC ACID-INSENSITIVE4 in the Control of Seed Germination.2015 · DOI: 10.1104/pp.15.00162 The MYB96-HHP module integrates cold and abscisic acid signaling to activate the CBF-COR pathway in Arabidopsis.2015 · DOI: 10.1111/tpj.12866 MYB96 shapes the circadian gating of ABA signaling in Arabidopsis.2016 · DOI: 10.1038/srep17754 MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis.2016 · DOI: 10.1093/pcp/pcw147 MYB96 recruits the HDA15 protein to suppress negative regulators of ABA signaling in Arabidopsis.2019 · DOI: 10.1038/s41467-019-09417-1
`At3g47600`	Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress.	Cuticular wax biosynthesis is up-regulated by the MYB94 transcription factor in Arabidopsis.2015 · DOI: 10.1093/pcp/pcu142 MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis.2016 · DOI: 10.1093/pcp/pcw147
`At3g28910`	Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3'.	A novel myb oncogene homologue in Arabidopsis thaliana related to hypersensitive cell death.1999 · DOI: 10.1046/j.1365-313x.1999.00578.x A R2R3-MYB gene, AtMYB30, acts as a positive regulator of the hypersensitive cell death program in plants in response to pathogen attack.2002 · DOI: 10.1073/pnas.152047199 An essential role for salicylic acid in AtMYB30-mediated control of the hypersensitive cell death program in Arabidopsis.2006 · DOI: 10.1016/j.febslet.2006.05.027 A MYB transcription factor regulates very-long-chain fatty acid biosynthesis for activation of the hypersensitive cell death response in Arabidopsis.2008 · DOI: 10.1105/tpc.107.054858 Arabidopsis MYB30 is a direct target of BES1 and cooperates with BES1 to regulate brassinosteroid-induced gene expression.2009 · DOI: 10.1111/j.1365-313x.2008.03778.x AtsPLA2-alpha nuclear relocalization by the Arabidopsis transcription factor AtMYB30 leads to repression of the plant defense response.2010 · DOI: 10.1073/pnas.1009056107 Sumoylation of transcription factor MYB30 by the small ubiquitin-like modifier E3 ligase SIZ1 mediates abscisic acid response in Arabidopsis thaliana.2012 · DOI: 10.1073/pnas.1202630109 Elevated levels of MYB30 in the phloem accelerate flowering in Arabidopsis through the regulation of FLOWERING LOCUS T.2014 · DOI: 10.1371/journal.pone.0089799

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008642 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

KEGG gene cross-reference

ath:AT3G28910

ath:AT3G47600

ath:AT5G62470

vvi:100233072

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.850

Rank 1 · LXL04_008642 · OH-1004

Cytoplasm0.276

Rank 2 · LXL04_008642 · OH-1004

Mitochondrion0.028

Rank 3 · LXL04_008642 · OH-1004

Cell membrane0.022

Rank 4 · LXL04_008642 · OH-1004

Lysosome / Vacuole0.012

Rank 5 · LXL04_008642 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding14-61 aa

PF13921.13Myb_DNA-bind_617-77 aa

PF00249.38Myb_DNA-binding67-112 aa

PF13921.13Myb_DNA-bind_670-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008642	`PF00249.38`	Myb_DNA-binding	14	61	5.3e-34	116.8
LXL04_008642	`PF13921.13`	Myb_DNA-bind_6	17	77	5.6e-19	68.8
LXL04_008642	`PF00249.38`	Myb_DNA-binding	67	112	5.3e-34	116.8
LXL04_008642	`PF13921.13`	Myb_DNA-bind_6	70	118	5.6e-19	68.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q24JK1`	Arabidopsis thaliana	Transcription factor MYB96	50.975%	Swiss-Prot	strong database homology
`Q9SN78`	Arabidopsis thaliana	Transcription factor MYB94	51.775%	Swiss-Prot	strong database homology
`Q9SCU7`	Arabidopsis thaliana	Transcription factor MYB30	52.711%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card