LXL04_008618 | RubberDandelionOmics

Gene overview

LXL04_008618

Reference: OH-1004 Chr: Chr02 Coordinates: 104403590-104405053 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

978 bp · LXL04_008618|LXL04_008618|OH1004|cDNA

ATGGCAGCTCGGAGCTTTCTCTACGGCGGCAATTCTGGTGGTGGAGCCGGCGGTTTTAACTCTGTTCTGCTAACAAACAAGAGGgcgatttcttcttcttcttctaaaCCTCTTGATTCCTTCTTCGTTTCTGGATCATCTCATTCTTTTGCAGGTTCTAGATCAATGGTTAGCTTTGAGGACGGAGGAAACGGATCAGGAAGGAGCTTTTTTCAGCCGTTCGATCAGGAAGACAATGGCGATGATGAATACGACGACTA...

CDS

Download CDS FASTA

978 bp · LXL04_008618|LXL04_008618|OH1004|CDS

ATGGCAGCTCGGAGCTTTCTCTACGGCGGCAATTCTGGTGGTGGAGCCGGCGGTTTTAACTCTGTTCTGCTAACAAACAAGAGGGCGATTTCTTCTTCTTCTTCTAAACCTCTTGATTCCTTCTTCGTTTCTGGATCATCTCATTCTTTTGCAGGTTCTAGATCAATGGTTAGCTTTGAGGACGGAGGAAACGGATCAGGAAGGAGCTTTTTTCAGCCGTTCGATCAGGAAGACAATGGCGATGATGAATACGACGACTA...

Protein

Download Protein FASTA

325 aa · LXL04_008618|LXL04_008618|OH1004|PROTEIN

MAARSFLYGGNSGGGAGGFNSVLLTNKRAISSSSSKPLDSFFVSGSSHSFAGSRSMVSFEDGGNGSGRSFFQPFDQEDNGDDEYDDYLQQPEKKRRLKSDQVQFLEKSFETDNKLEPDRKIQLAKDLGLQPRQIAIWFQNRRARWKTKQLEKDYDVLQESFNELKSKYDNLLQEKEKLKSEVHDLSDKLLLQEMEKGTSDSSSTKSPSEPLQQEQAADCLNDEDHISKTSIVDVNSDLTGSSSPRYADLLERGNSSYLFE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008618`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008618

Location Chr02:104403590-104405053 (+)

Description Similar to HAT5: Homeobox-leucine zipper protein HAT5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01470`	Probable transcription activator involved in leaf development.	Ectopic expression of the Arabidopsis transcriptional activator Athb-1 alters leaf cell fate in tobacco.1995 · DOI: 10.1105/tpc.7.11.1773
`At1g69780`	Probable transcription factor that may act in the sucrose-signaling pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0729700`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2X980`	Probable transcription factor.	No verified direct reference in this release
`Os08g0481400`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008618 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009637 response to blue light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048826 cotyledon morphogenesis Biological Process

GO:0080022 primary root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

KEGG gene cross-reference

ath:AT1G69780

ath:AT3G01470

dosa:Os02g0729700

dosa:Os08g0481400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · LXL04_008618 · OH-1004

Cytoplasm0.088

Rank 2 · LXL04_008618 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_008618 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_008618 · OH-1004

Plastid0.012

Rank 5 · LXL04_008618 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain93-146 aa

PF02183.24HALZ148-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008618	`PF00046.36`	Homeodomain	93	146	5.8e-17	62.0
LXL04_008618	`PF02183.24`	HALZ	148	189	5.4e-14	52.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q02283`	Arabidopsis thaliana	Homeobox-leucine zipper protein HAT5	47.541%	Swiss-Prot	moderate database homology
`Q8LC03`	Arabidopsis thaliana	Homeobox-leucine zipper protein ATHB-13	46.552%	Swiss-Prot	moderate database homology
`Q6YWR4`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein HOX16	49.057%	Swiss-Prot	weak database homology
`A2X980`	Oryza sativa subsp. indica	Homeobox-leucine zipper protein HOX16	49.057%	Swiss-Prot	weak database homology
`Q6Z248`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein HOX20	61.224%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card