LXL04_008615 | RubberDandelionOmics

Gene overview

LXL04_008615

Reference: OH-1004 Chr: Chr02 Coordinates: 104293611-104296146 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1968 bp · LXL04_008615|LXL04_008615|OH1004|cDNA

ATGGAAAGCGGCCGTCATTCTTCGGCCGCCATGGAGGAACAAAAAACACCGATTACAGAGAAAGGTGGCTGGAAATCCATCAAATACATTATCGGGAATGAGTCGTTTGAGAAATTGGCGTCGATGAGTTTGATTATAAACATGACGCTTTATTTACGATCAAAGTACAACCTGAATGGCATTTTCCTTATAAATGTGGTTACCATTTGGAATGGCACCTCCAATCTTTCAACGTTGGCCGGTGCTTTCATCTCCGACGC...

CDS

Download CDS FASTA

1968 bp · LXL04_008615|LXL04_008615|OH1004|CDS

ATGGAAAGCGGCCGTCATTCTTCGGCCGCCATGGAGGAACAAAAAACACCGATTACAGAGAAAGGTGGCTGGAAATCCATCAAATACATTATCGGGAATGAGTCGTTTGAGAAATTGGCGTCGATGAGTTTGATTATAAACATGACGCTTTATTTACGATCAAAGTACAACCTGAATGGCATTTTCCTTATAAATGTGGTTACCATTTGGAATGGCACCTCCAATCTTTCAACGTTGGCCGGTGCTTTCATCTCCGACGC...

Protein

Download Protein FASTA

655 aa · LXL04_008615|LXL04_008615|OH1004|PROTEIN

MESGRHSSAAMEEQKTPITEKGGWKSIKYIIGNESFEKLASMSLIINMTLYLRSKYNLNGIFLINVVTIWNGTSNLSTLAGAFISDAYIGRFLTLFLGSIISLLGMGLMTLTAGVPNLRPPNCNDGINCVQPENWQLGLLFAGLGLLALGAGGLRPCGIAFGADQFDTNTAKGKKQLESFFNLWYLSFTLALLVALTGVVYIQTNISWVIGFAIPTACLLFSFILFLVGRHTYVMKKPVGSVLSDIARVIVASIRKRKIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008615`
TK1151 ID	TkA03G353000
OH-1004 ID	LXL04_008615
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.200 / OH-1004 75.725 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008615

Location Chr02:104293611-104296146 (-)

Description Similar to NPF2.8: Protein NRT1/ PTR FAMILY 2.8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28470`	Protein NRT1/ PTR FAMILY 2.8.	No verified direct reference in this release
`At1g69870`	Low-affinity proton-dependent nitrate transporter.	The Arabidopsis nitrate transporter NRT1.7, expressed in phloem, is responsible for source-to-sink remobilization of nitrate.2009 · DOI: 10.1105/tpc.109.067603
`At1g27080`	Low-affinity proton-dependent nitrate transporter.	No verified direct reference in this release
`At5g62680`	High-affinity, proton-dependent glucosinolate-specific transporter.	NRT/PTR transporters are essential for translocation of glucosinolate defence compounds to seeds.2012 · DOI: 10.1038/nature11285 Integration of biosynthesis and long-distance transport establish organ-specific glucosinolate profiles in vegetative Arabidopsis.2013 · DOI: 10.1105/tpc.113.110890
`At1g18880`	Low-affinity nitrate transporter facilitating nitrate loading into root phloem.	Arabidopsis nitrate transporter NRT1.9 is important in phloem nitrate transport.2011 · DOI: 10.1105/tpc.111.083618

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008615 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006857 oligopeptide transport Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010098 suspensor development Biological Process

GO:0010233 phloem transport Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0043562 cellular response to nitrogen levels Biological Process

GO:0048316 seed development Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0090408 phloem nitrate loading Biological Process

KEGG gene cross-reference

ath:AT1G18880

ath:AT1G27080

ath:AT1G69870

ath:AT5G28470

ath:AT5G62680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.832

Rank 1 · LXL04_008615 · OH-1004

Cytoplasm0.080

Rank 2 · LXL04_008615 · OH-1004

Endoplasmic reticulum0.067

Rank 3 · LXL04_008615 · OH-1004

Lysosome / Vacuole0.039

Rank 4 · LXL04_008615 · OH-1004

Mitochondrion0.029

Rank 5 · LXL04_008615 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00854.28PTR292-524 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008615	`PF00854.28`	PTR2	92	524	1.1e-77	262.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E8X3`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.8	56.360%	Swiss-Prot	strong database homology
`Q8RX77`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.13	42.294%	Swiss-Prot	moderate database homology
`Q9LFX9`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.12	43.718%	Swiss-Prot	moderate database homology
`Q9LV10`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.11	37.456%	Swiss-Prot	moderate database homology
`Q9M9V7`	Arabidopsis thaliana	Protein NRT1/ PTR FAMILY 2.9	39.123%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card