LXL04_008604 | RubberDandelionOmics

Gene overview

LXL04_008604

Reference: OH-1004 Chr: Chr02 Coordinates: 103922710-103925873 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1728 bp · LXL04_008604|LXL04_008604|OH1004|cDNA

ATGCCCGCCTCTCCAAATCTTGATTTTCCGGTGATCATAACTATACTTCCCAACAACCACCAACGGAACAAGAAATTAAAACCTACCTCCACCATGGGCAACTGCACCACCTGTCTAAGACCCGATGATCCGAAACCCAAACACTACCAACCACCTCCAACTCCACAGGGCAAGAAAAAACACAGACCCAACCCATACGCCGAATCGCCGGTACCGATCCGGGTGTTGAACGACATCGGACAACTCGCCCACCACCGTAC...

CDS

Download CDS FASTA

1728 bp · LXL04_008604|LXL04_008604|OH1004|CDS

ATGCCCGCCTCTCCAAATCTTGATTTTCCGGTGATCATAACTATACTTCCCAACAACCACCAACGGAACAAGAAATTAAAACCTACCTCCACCATGGGCAACTGCACCACCTGTCTAAGACCCGATGATCCGAAACCCAAACACTACCAACCACCTCCAACTCCACAGGGCAAGAAAAAACACAGACCCAACCCATACGCCGAATCGCCGGTACCGATCCGGGTGTTGAACGACATCGGACAACTCGCCCACCACCGTAC...

Protein

Download Protein FASTA

575 aa · LXL04_008604|LXL04_008604|OH1004|PROTEIN

MPASPNLDFPVIITILPNNHQRNKKLKPTSTMGNCTTCLRPDDPKPKHYQPPPTPQGKKKHRPNPYAESPVPIRVLNDIGQLAHHRTRISYKYILGRELGRGEFGVTYLCTDRETKQAFACKSISKKKLRTAVDVEDVRREVAIMSTLPEHPNIVKLRATYEDHEAVHLVMELCEGGELFDRIVARGQYSERAAAEIAKTVAEVVKMCHENGVIHRDLKPENFLFANKKENSALKVIDFGLSVFWKPGQKFSEIGGSPYY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008604`
TK1151 ID	TkA03G353910
OH-1004 ID	LXL04_008604
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.600
Protein coverage (%)	TK1151 99.524 / OH-1004 36.174 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008604

Location Chr02:103922710-103925873 (+)

Description Similar to CPK30: Calcium-dependent protein kinase 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74740`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At1g18890`	May play a role in signal transduction pathways that involve calcium as a second messenger.	Two genes that encode Ca(2+)-dependent protein kinases are induced by drought and high-salt stresses in Arabidopsis thaliana.1994 · DOI: 10.1007/bf00286684

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0688300`	May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).	A rice calcium-dependent protein kinase OsCPK9 positively regulates drought stress tolerance and spikelet fertility.2014 · DOI: 10.1186/1471-2229-14-133
`Os01g0832300`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`Os07g0568600`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008604 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010152 pollen maturation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G18890

ath:AT1G74740

dosa:Os01g0832300

dosa:Os03g0688300

dosa:Os07g0568600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.551

Rank 1 · LXL04_008604 · OH-1004

Cytoplasm0.357

Rank 2 · LXL04_008604 · OH-1004

Nucleus0.235

Rank 3 · LXL04_008604 · OH-1004

Golgi apparatus0.054

Rank 4 · LXL04_008604 · OH-1004

Endoplasmic reticulum0.053

Rank 5 · LXL04_008604 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase94-351 aa

PF07714.24PK_Tyr_Ser-Thr95-347 aa

PF06293.21Kdo120-240 aa

PF14531.13Kinase-like190-339 aa

PF13499.13EF-hand_7398-458 aa

PF00036.39EF-hand_1399-425 aa

PF13405.13EF-hand_6399-427 aa

PF13202.13EF-hand_5399-421 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008604	`PF00069.32`	Pkinase	94	351	4.1e-79	266.4
LXL04_008604	`PF07714.24`	PK_Tyr_Ser-Thr	95	347	8.1e-30	104.7
LXL04_008604	`PF06293.21`	Kdo	120	240	9.1e-08	32.5
LXL04_008604	`PF14531.13`	Kinase-like	190	339	3.9e-06	27.0
LXL04_008604	`PF13499.13`	EF-hand_7	398	458	1.6e-28	99.6
LXL04_008604	`PF00036.39`	EF-hand_1	399	425	1.6e-30	103.1
LXL04_008604	`PF13405.13`	EF-hand_6	399	427	5.2e-24	82.3
LXL04_008604	`PF13202.13`	EF-hand_5	399	421	2.7e-20	71.5
LXL04_008604	`PF13499.13`	EF-hand_7	469	532	1.6e-28	99.6
LXL04_008604	`PF00036.39`	EF-hand_1	471	496	1.6e-30	103.1
LXL04_008604	`PF13405.13`	EF-hand_6	471	496	5.2e-24	82.3
LXL04_008604	`PF25825.2`	SAPC2_N	471	533	5.5e-09	36.5
LXL04_008604	`PF13202.13`	EF-hand_5	472	495	2.7e-20	71.5
LXL04_008604	`PF00036.39`	EF-hand_1	507	533	1.6e-30	103.1
LXL04_008604	`PF13405.13`	EF-hand_6	507	533	5.2e-24	82.3
LXL04_008604	`PF13833.13`	EF-hand_8	507	532	1.9e-13	50.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSF8`	Arabidopsis thaliana	Calcium-dependent protein kinase 30	74.592%	Swiss-Prot	strong database homology
`Q9M9V8`	Arabidopsis thaliana	Calcium-dependent protein kinase 10	75.458%	Swiss-Prot	strong database homology
`Q6AVI8`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 9	68.182%	Swiss-Prot	strong database homology
`Q8LPZ7`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 3	71.849%	Swiss-Prot	strong database homology
`Q84SL0`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 20	71.008%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card