RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_008598
Reference: OH-1004 Chr: Chr02 Coordinates: 103790308-103791667 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

606 bp · LXL04_008598|LXL04_008598|OH1004|cDNA

atgccttccgccaaggatcggggtgtgacaaAAACCACTTGGATTCGTTTCAGAGGGGTCGAGAGCTACTGGCGTGGTGTCTCTCAGAAGCGCAGACCTCGTGCAGGCCTTGATCGATGCAGTAAGTTTTTAATTCAGATCGATCATAGTAGAGCTAGCATGATCGGAAGCAGTGCTACAACGGAAGTCATTCTCGATAGCGGCATAAACAATGTCCTCCAACTTATGCAAGCGGAGATTCAGCTCATTTCACCTTCAGT...

CDS

Download CDS FASTA

606 bp · LXL04_008598|LXL04_008598|OH1004|CDS

ATGCCTTCCGCCAAGGATCGGGGTGTGACAAAAACCACTTGGATTCGTTTCAGAGGGGTCGAGAGCTACTGGCGTGGTGTCTCTCAGAAGCGCAGACCTCGTGCAGGCCTTGATCGATGCAGTAAGTTTTTAATTCAGATCGATCATAGTAGAGCTAGCATGATCGGAAGCAGTGCTACAACGGAAGTCATTCTCGATAGCGGCATAAACAATGTCCTCCAACTTATGCAAGCGGAGATTCAGCTCATTTCACCTTCAGT...

Protein

Download Protein FASTA

201 aa · LXL04_008598|LXL04_008598|OH1004|PROTEIN

MPSAKDRGVTKTTWIRFRGVESYWRGVSQKRRPRAGLDRCSKFLIQIDHSRASMIGSSATTEVILDSGINNVLQLMQAEIQLISPSVPARGMKFFQFSSQQAEGVWAMVDLSFDVNDNGSMCRRLPSGCILYQLFFIAFQVFDKMPRRTMIKCVFAETCERVMLPRMTNLDYKRKRRVISLGMCSLTTFPCFTIVSNSSCI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_008598
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_008598
LocationChr02:103790308-103791667 (+)
DescriptionSimilar to HDG1: Homeobox-leucine zipper protein HDG1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g61150 Probable transcription factor (By similarity).
CFL1, a WW domain protein, regulates cuticle development by modulating the function of HDG1, a class IV homeodomain transcription factor, in rice and Arabidopsis.2011 · DOI: 10.1105/tpc.111.088625
Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12211
At4g00730 Probable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root.
ANTHOCYANINLESS2, a homeobox gene affecting anthocyanin distribution and root development in Arabidopsis.1999 · DOI: 10.1105/tpc.11.7.1217
At1g05230 Probable transcription factor (By similarity).
Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12211

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0569100 Probable transcription factor. No verified direct reference in this release
Os02g0674800 Probable transcription factor. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_008598 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0009827 plant-type cell wall modification Biological Process
GO:0010090 trichome morphogenesis Biological Process
GO:0010143 cutin biosynthetic process Biological Process
GO:0010214 seed coat development Biological Process
GO:0030154 cell differentiation Biological Process
GO:0043481 anthocyanin accumulation in tissues in response to UV light Biological Process
GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process
GO:0048364 root development Biological Process
GO:0048497 maintenance of floral organ identity Biological Process
GO:0048765 root hair cell differentiation Biological Process
GO:0052541 plant-type cell wall cellulose metabolic process Biological Process
KEGG gene cross-reference
ath:AT1G05230
ath:AT3G61150
ath:AT4G00730
dosa:Os02g0674800
dosa:Os04g0569100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.388
Rank 1 · LXL04_008598 · OH-1004
Cytoplasm0.346
Rank 2 · LXL04_008598 · OH-1004
Mitochondrion0.144
Rank 3 · LXL04_008598 · OH-1004
Cell membrane0.144
Rank 4 · LXL04_008598 · OH-1004
Endoplasmic reticulum0.076
Rank 5 · LXL04_008598 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01852.26START60-131 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_008598PF01852.26START601313.1e-0627.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M2E8Arabidopsis thalianaHomeobox-leucine zipper protein HDG150.000%Swiss-Protweak database homology
Q0WV12Arabidopsis thalianaHomeobox-leucine zipper protein ANTHOCYANINLESS 247.619%Swiss-Protweak database homology
Q94C37Arabidopsis thalianaHomeobox-leucine zipper protein HDG240.449%Swiss-Protweak database homology
Q7Y0V9Oryza sativa subsp. japonicaHomeobox-leucine zipper protein ROC444.118%Swiss-Protweak database homology
Q6EPF0Oryza sativa subsp. japonicaHomeobox-leucine zipper protein ROC546.575%Swiss-Protweak database homology

JBrowse

View in Genome Browser