LXL04_008588 | RubberDandelionOmics

Gene overview

LXL04_008588

Reference: OH-1004 Chr: Chr02 Coordinates: 103391992-103394569 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

540 bp · LXL04_008588|LXL04_008588|OH1004|cDNA

ATGAAAATGAGCATCCAGAACGACAATCACATTGGTTACGATCGTGTTTATCCCCCACCTCTGTCCTCCGTTCCTACAGCGTCGCCACCGTCGCAGCAGGTTCCCGACAATCGTAACCAACAGATAAACCTAAACAAGGAAGCCGCATCCATATCATTGATTCCGTCGGCCATATCCTTCCCGATGCAGCAGCTTCAGGTGTCATTGACGGTGGATAAAATGCGGAAATTGGGGTTGGATGGACCTGATTTTGAAGAGAA...

CDS

Download CDS FASTA

540 bp · LXL04_008588|LXL04_008588|OH1004|CDS

ATGAAAATGAGCATCCAGAACGACAATCACATTGGTTACGATCGTGTTTATCCCCCACCTCTGTCCTCCGTTCCTACAGCGTCGCCACCGTCGCAGCAGGTTCCCGACAATCGTAACCAACAGATAAACCTAAACAAGGAAGCCGCATCCATATCATTGATTCCGTCGGCCATATCCTTCCCGATGCAGCAGCTTCAGGTGTCATTGACGGTGGATAAAATGCGGAAATTGGGGTTGGATGGACCTGATTTTGAAGAGAA...

Protein

Download Protein FASTA

179 aa · LXL04_008588|LXL04_008588|OH1004|PROTEIN

MKMSIQNDNHIGYDRVYPPPLSSVPTASPPSQQVPDNRNQQINLNKEAASISLIPSAISFPMQQLQVSLTVDKMRKLGLDGPDFEEKTCAPESNLLFRRPFGCSSHHNHQRIAMILSNYRVQIPLSVSGAANDGISLTVFGVRFSDKTITLTRNLMGFFKRSIGEETYGNGVTQLELGE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008588`
TK1151 ID	TkA03G356090
OH-1004 ID	LXL04_008588
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 96.000 / OH-1004 53.631 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008588

Location Chr02:103391992-103394569 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g59820`	Involved in transport of phospholipids.	The Arabidopsis P4-ATPase ALA3 localizes to the golgi and requires a beta-subunit to function in lipid translocation and secretory vesicle formation.2008 · DOI: 10.1105/tpc.107.054767 IRREGULAR TRICHOME BRANCH 2 (ITB2) encodes a putative aminophospholipid translocase that regulates trichome branch elongation in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03954.x Intracellular targeting signals and lipid specificity determinants of the ALA/ALIS P4-ATPase complex reside in the catalytic ALA alpha-subunit.2010 · DOI: 10.1091/mbc.e09-08-0656 Loss of the Arabidopsis thaliana P₄-ATPase ALA3 reduces adaptability to temperature stresses and impairs vegetative, pollen, and ovule development.2013 · DOI: 10.1371/journal.pone.0062577 An Arabidopsis Lipid Flippase Is Required for Timely Recruitment of Defenses to the Host-Pathogen Interface at the Plant Cell Surface.2017 · DOI: 10.1016/j.molp.2017.04.003

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008588 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045332 phospholipid translocation Biological Process

GO:0048194 Golgi vesicle budding Biological Process

GO:0048364 root development Biological Process

KEGG gene cross-reference

ath:AT1G59820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.445

Rank 1 · LXL04_008588 · OH-1004

Cytoplasm0.362

Rank 2 · LXL04_008588 · OH-1004

Cell membrane0.136

Rank 3 · LXL04_008588 · OH-1004

Mitochondrion0.087

Rank 4 · LXL04_008588 · OH-1004

Endoplasmic reticulum0.079

Rank 5 · LXL04_008588 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XIE6`	Arabidopsis thaliana	Phospholipid-transporting ATPase 3	71.429%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card