LXL04_008561 | RubberDandelionOmics

Gene overview

LXL04_008561

Reference: OH-1004 Chr: Chr02 Coordinates: 102800228-102800974 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

522 bp · LXL04_008561|LXL04_008561|OH1004|cDNA

ATGAAGGAAGCTGCGGGAAATCCTCTGCACCTCAAGTCGTTAAATCACATCTCGCTCGTATGCCGGTCGGTTGAAGAATCTATCGATTTCTATACGAACGTTCTTGGATTTTTCCCGATCAGAAGGCCTGGGTCTTTTGATTTCGATGGTGCATGGCTGTTTAACTACGGAATTGGGATTCATTTATTGCAAGCCGAACGCCCTGATAATTTGCCGAAAAAACGCGAAATAAATCCGAAAGATAATCATATTTCGTTCCA...

CDS

Download CDS FASTA

522 bp · LXL04_008561|LXL04_008561|OH1004|CDS

ATGAAGGAAGCTGCGGGAAATCCTCTGCACCTCAAGTCGTTAAATCACATCTCGCTCGTATGCCGGTCGGTTGAAGAATCTATCGATTTCTATACGAACGTTCTTGGATTTTTCCCGATCAGAAGGCCTGGGTCTTTTGATTTCGATGGTGCATGGCTGTTTAACTACGGAATTGGGATTCATTTATTGCAAGCCGAACGCCCTGATAATTTGCCGAAAAAACGCGAAATAAATCCGAAAGATAATCATATTTCGTTCCA...

Protein

Download Protein FASTA

173 aa · LXL04_008561|LXL04_008561|OH1004|PROTEIN

MKEAAGNPLHLKSLNHISLVCRSVEESIDFYTNVLGFFPIRRPGSFDFDGAWLFNYGIGIHLLQAERPDNLPKKREINPKDNHISFQCESMGAVEKKLKEMEIVYKRQRVEEGGIYVDQLFFHDPDGFMVEICNCDNLPVIPLAGEMIRSCSRLNLDIISQKQNTSICSAVTQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008561`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008561

Location Chr02:102800228-102800974 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15380`	Involved in the detoxification and scavenging of methylglyoxal (MG), a cytotoxic aldehyde produced in response to primary metabolism alteration observed during biotic and abiotic stresses.	Genome-wide association study reveals novel players in defense hormone crosstalk in Arabidopsis.2018 · DOI: 10.1111/pce.13357 GLYI4 Plays A Role in Methylglyoxal Detoxification and Jasmonate-Mediated Stress Responses in Arabidopsis thaliana .2019 · DOI: 10.3390/biom9100635

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008561 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010045 response to nickel cation Biological Process

GO:0010224 response to UV-B Biological Process

GO:0051595 response to methylglyoxal Biological Process

KEGG gene cross-reference

ath:AT1G15380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.446

Rank 1 · LXL04_008561 · OH-1004

Nucleus0.233

Rank 2 · LXL04_008561 · OH-1004

Cell membrane0.209

Rank 3 · LXL04_008561 · OH-1004

Golgi apparatus0.126

Rank 4 · LXL04_008561 · OH-1004

Endoplasmic reticulum0.121

Rank 5 · LXL04_008561 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00903.32Glyoxalase14-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008561	`PF00903.32`	Glyoxalase	14	132	1.7e-13	51.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XI31`	Arabidopsis thaliana	Glyoxylase I 4	73.006%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card