LXL04_008511 | RubberDandelionOmics

Gene overview

LXL04_008511

Reference: OH-1004 Chr: Chr02 Coordinates: 101578627-101583204 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2619 bp · LXL04_008511|LXL04_008511|OH1004|cDNA

ATGAATGAAACATCTTCTCTTGATTCTATGTTTTGGCAGAAATCTTATGAAACAAAACAGTATAAAAAGGGGCTGAAGGCTGCAGATGCTATATTGAAGAAGTTCCCAGATCATGGAGAAACTCTTTCAATGAAAGGATTAACCTTGAATTGTATGGACCGTAAGTCAGAAGCATATGAGCTAGTACGATTGGGTTTAAAGAATGACTTGAAAAGCCATGTTTGCTGGCACGTTTATGGTCTTCTGTATCGGTCAGACCG...

CDS

Download CDS FASTA

2619 bp · LXL04_008511|LXL04_008511|OH1004|CDS

ATGAATGAAACATCTTCTCTTGATTCTATGTTTTGGCAGAAATCTTATGAAACAAAACAGTATAAAAAGGGGCTGAAGGCTGCAGATGCTATATTGAAGAAGTTCCCAGATCATGGAGAAACTCTTTCAATGAAAGGATTAACCTTGAATTGTATGGACCGTAAGTCAGAAGCATATGAGCTAGTACGATTGGGTTTAAAGAATGACTTGAAAAGCCATGTTTGCTGGCACGTTTATGGTCTTCTGTATCGGTCAGACCG...

Protein

Download Protein FASTA

872 aa · LXL04_008511|LXL04_008511|OH1004|PROTEIN

MNETSSLDSMFWQKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKSEAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNASKAVDILEAYEGTLEDDYPPDNERCEHGEMLLYKISLLEECGLVEKALQELHKKEFKIVDKLSYKEEEVSLLVKLNRFEEGEKLYKVLLSMNPDNYKYYEGLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008511`
TK1151 ID	TkA03G363870
OH-1004 ID	LXL04_008511
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 73.077 / OH-1004 10.894 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008511

Location Chr02:101578627-101583204 (+)

Description Similar to NAA15: N-terminal acetyltransferase A complex auxiliary subunit NAA15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80410`	Auxiliary subunit of the NatA N-alpha-acetyltransferase complex.	Protein N-terminal acetylation is required for embryogenesis in Arabidopsis.2016 · DOI: 10.1093/jxb/erw257 NatA is required for suspensor development in Arabidopsis.2016 · DOI: 10.1080/15592324.2016.1231293

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008511 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050821 protein stabilization Biological Process

GO:0051604 protein maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005667 transcription regulator complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G80410

hsa:79612

hsa:80155

mmu:66897

pon:100173970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.585

Rank 1 · LXL04_008511 · OH-1004

Nucleus0.371

Rank 2 · LXL04_008511 · OH-1004

Golgi apparatus0.093

Rank 3 · LXL04_008511 · OH-1004

Endoplasmic reticulum0.084

Rank 4 · LXL04_008511 · OH-1004

Cell membrane0.075

Rank 5 · LXL04_008511 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31234.1TPR_Psidin_N17-246 aa

PF13428.13TPR_1475-113 aa

PF07719.24TPR_275-106 aa

PF13181.13TPR_876-106 aa

PF13414.13TPR_1180-119 aa

PF00515.35TPR_180-106 aa

PF12569.15NatA_aux_su183-692 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008511	`PF31234.1`	TPR_Psidin_N	17	246	1.1e-12	48.7
LXL04_008511	`PF13428.13`	TPR_14	75	113	1.5e-14	53.7
LXL04_008511	`PF07719.24`	TPR_2	75	106	1.5e-12	47.3
LXL04_008511	`PF13181.13`	TPR_8	76	106	1.3e-07	31.9
LXL04_008511	`PF13414.13`	TPR_11	80	119	1.2e-08	35.2
LXL04_008511	`PF00515.35`	TPR_1	80	106	3.3e-08	33.7
LXL04_008511	`PF12569.15`	NatA_aux_su	183	692	2.5e-200	667.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZM1`	Arabidopsis thaliana	N-terminal acetyltransferase A complex auxiliary subunit NAA15	74.332%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card