LXL04_008498 | RubberDandelionOmics

Gene overview

LXL04_008498

Reference: OH-1004 Chr: Chr02 Coordinates: 101366663-101370355 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

753 bp · LXL04_008498|LXL04_008498|OH1004|cDNA

ATGGCAGTGTTGCTTCACCGACGACGAAGACCTAAAATCTTTCCTTCAACCTCTCAGCGATGTTTACTCGCGGCTAAAAACTTATCGGTTTTAATTGAGGAAATATTTTTGCTTCTTCTACATTGGTCTGATCAAAAAGGAATCTCCAATGCACTTTCTAATAGTGACGTAAAGATCTTTTACAAGATTCCTGGTTTTAAGTGGAGCATTTTGATTGAAGTTCTTGAATGGAAACTTCAACGGCTTGAGGTAATGGTAGT...

CDS

Download CDS FASTA

753 bp · LXL04_008498|LXL04_008498|OH1004|CDS

ATGGCAGTGTTGCTTCACCGACGACGAAGACCTAAAATCTTTCCTTCAACCTCTCAGCGATGTTTACTCGCGGCTAAAAACTTATCGGTTTTAATTGAGGAAATATTTTTGCTTCTTCTACATTGGTCTGATCAAAAAGGAATCTCCAATGCACTTTCTAATAGTGACGTAAAGATCTTTTACAAGATTCCTGGTTTTAAGTGGAGCATTTTGATTGAAGTTCTTGAATGGAAACTTCAACGGCTTGAGGTAATGGTAGT...

Protein

Download Protein FASTA

250 aa · LXL04_008498|LXL04_008498|OH1004|PROTEIN

MAVLLHRRRRPKIFPSTSQRCLLAAKNLSVLIEEIFLLLLHWSDQKGISNALSNSDVKIFYKIPGFKWSILIEVLEWKLQRLEVMVVLLLGWSKIVNEMEGYDAFGNDLYEIPEAMPVVSNNPLQDAPTPSKADEYSKIQALIDAPILDWRKLSTTLVVNLTEKTGFISCFGVVLPSKLLNLRLRCIVSNQDIWYLDHLDATWQQFYTNEQTIWPHAAAVVGRFWTNVGRLAKDPKNVGLRLMHFRCLLN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008498`
TK1151 ID	TkA07G346510
OH-1004 ID	LXL04_008498
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	73.000
Protein coverage (%)	TK1151 11.923 / OH-1004 25.200 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008498

Location Chr02:101366663-101370355 (-)

Description Similar to HEXO3: Beta-hexosaminidase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65590`	Has a broad substrate specificity.	Biosynthesis of truncated N-linked oligosaccharides results from non-orthologous hexosaminidase-mediated mechanisms in nematodes, plants, and insects.2007 · DOI: 10.1074/jbc.m704235200 Enzymatic properties and subcellular localization of Arabidopsis beta-N-acetylhexosaminidases.2007 · DOI: 10.1104/pp.107.101162 Beta-N-acetylhexosaminidases HEXO1 and HEXO3 are responsible for the formation of paucimannosidic N-glycans in Arabidopsis thaliana.2011 · DOI: 10.1074/jbc.m110.178020
`At4g17410`	May act as an E3 ubiquitin ligase that negatively regulates oxidative stress tolerance.	PARAQUAT TOLERANCE3 Is an E3 Ligase That Switches off Activated Oxidative Response by Targeting Histone-Modifying PROTEIN METHYLTRANSFERASE4b.2016 · DOI: 10.1371/journal.pgen.1006332
`At5g47430`	E3 ubiquitin ligase PQT3-like.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008498 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006491 N-glycan processing Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010555 response to mannitol Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030203 glycosaminoglycan metabolic process Biological Process

GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

KEGG gene cross-reference

ath:AT1G65590

ath:AT4G17410

ath:AT5G47430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.327

Rank 1 · LXL04_008498 · OH-1004

Cytoplasm0.306

Rank 2 · LXL04_008498 · OH-1004

Cell membrane0.153

Rank 3 · LXL04_008498 · OH-1004

Endoplasmic reticulum0.146

Rank 4 · LXL04_008498 · OH-1004

Mitochondrion0.124

Rank 5 · LXL04_008498 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7S6`	Arabidopsis thaliana	Beta-hexosaminidase 3	38.971%	Swiss-Prot	weak database homology
`F4JP52`	Arabidopsis thaliana	E3 ubiquitin ligase PARAQUAT TOLERANCE 3	52.941%	Swiss-Prot	weak database homology
`B9DFV2`	Arabidopsis thaliana	E3 ubiquitin ligase PQT3-like	50.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card