LXL04_008490 | RubberDandelionOmics

Gene overview

LXL04_008490

Reference: OH-1004 Chr: Chr02 Coordinates: 101032758-101035842 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2208 bp · LXL04_008490|LXL04_008490|OH1004|cDNA

ATGATGGGGTTTGCAATGGGAAGTTCATCTCCTTTACACTCCTCAACTTATCACTCTATTTTCccatctttttcttcatcttcgcAGCCCCTTTTCTTCCACTCTTGCCAAAGAAAACCACACGATCTCAGTAAGAAAAGAAAAGTTCATGCCTGTATGCAACACCATGAACCCAACGAAGACGACTTCTGCCAGAGAAGAGCGATTCTTATCATGGGTGCTTCTATTCTTCCGTTCTTGAATTTAAAATCAAGAGCTGC...

CDS

Download CDS FASTA

2208 bp · LXL04_008490|LXL04_008490|OH1004|CDS

ATGATGGGGTTTGCAATGGGAAGTTCATCTCCTTTACACTCCTCAACTTATCACTCTATTTTCCCATCTTTTTCTTCATCTTCGCAGCCCCTTTTCTTCCACTCTTGCCAAAGAAAACCACACGATCTCAGTAAGAAAAGAAAAGTTCATGCCTGTATGCAACACCATGAACCCAACGAAGACGACTTCTGCCAGAGAAGAGCGATTCTTATCATGGGTGCTTCTATTCTTCCGTTCTTGAATTTAAAATCAAGAGCTGC...

Protein

Download Protein FASTA

735 aa · LXL04_008490|LXL04_008490|OH1004|PROTEIN

MMGFAMGSSSPLHSSTYHSIFPSFSSSSQPLFFHSCQRKPHDLSKKRKVHACMQHHEPNEDDFCQRRAILIMGASILPFLNLKSRAAENSAPDELEDSARAQERSQMAEVSTNGDSTPNPFLTLSSGLGIVASGVLGAFYALAQKEKSANMLTIESMTTKLVEKEAAIVSMQKSFESKLQTEKEEKNEQLKKSNQEKQSLMSQLSSANSTVKGLGQELQKEKKVIQDLQNQIDGLNADLKKTFDDKEDLKLQVKDKLFSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008490`
TK1151 ID	TkA03G366870
OH-1004 ID	LXL04_008490
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.400
Protein coverage (%)	TK1151 98.611 / OH-1004 38.639 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008490

Location Chr02:101032758-101035842 (+)

Description Similar to MFP1-1: MAR-binding filament-like protein 1-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16000`	DNA-binding protein required for the initiation of starch granules biosynthesis in leaf chloroplasts.	MFP1 is a thylakoid-associated, nucleoid-binding protein with a coiled-coil structure.2003 · DOI: 10.1093/nar/gkg693 Two Plastidial Coiled-Coil Proteins Are Essential for Normal Starch Granule Initiation in Arabidopsis.2018 · DOI: 10.1105/tpc.18.00219 MFP1 defines the subchloroplast location of starch granule initiation.2024 · DOI: 10.1073/pnas.2309666121

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008490 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007155 cell adhesion Biological Process

GO:0007165 signal transduction Biological Process

GO:0009888 tissue development Biological Process

GO:0010581 regulation of starch biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0030334 regulation of cell migration Biological Process

GO:0045785 positive regulation of cell adhesion Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0110011 regulation of basement membrane organization Biological Process

GO:2001046 positive regulation of integrin-mediated signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005604 basement membrane Cellular Component

KEGG gene cross-reference

ath:AT3G16000

hsa:3908

mmu:16773

nta:107792739

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.953

Rank 1 · LXL04_008490 · OH-1004

Mitochondrion0.047

Rank 2 · LXL04_008490 · OH-1004

Peroxisome0.033

Rank 3 · LXL04_008490 · OH-1004

Cytoplasm0.032

Rank 4 · LXL04_008490 · OH-1004

Nucleus0.029

Rank 5 · LXL04_008490 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30378.1CEP135_TSGA10_CC154-437 aa

PF24161.2CCDC39172-456 aa

PF24161.2CCDC39383-687 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008490	`PF30378.1`	CEP135_TSGA10_CC	154	437	2.3e-10	40.1
LXL04_008490	`PF24161.2`	CCDC39	172	456	1.6e-09	37.0
LXL04_008490	`PF24161.2`	CCDC39	383	687	1.6e-09	37.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW85`	Arabidopsis thaliana	MAR-binding filament-like protein 1	41.417%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card