LXL04_008424 | RubberDandelionOmics

Gene overview

LXL04_008424

Reference: OH-1004 Chr: Chr02 Coordinates: 99306958-99308313 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

582 bp · LXL04_008424|LXL04_008424|OH1004|cDNA

ATGGTGCGGTTAGGGTTTGAATCAAGTCGATGCCTCATTTTTTTGCTTCTTTGTCGATTGAAATTGATTTTCGCTGAAGAGTTCATCGCTTCTATGGCTCTAATGTTGAAGTTTATCACTGATCAAGGACAGAAGGAGAAAAAAAACTTGGGAGTGAAAAATTTAAAAGTTGATAAAATCGACTGGAAAATTGATCGAAACGAGGACGTTGGGCCTCTCGCCGGAGTATTGGTTGCTATCAAAGACAACATTTGCACCGC...

CDS

Download CDS FASTA

582 bp · LXL04_008424|LXL04_008424|OH1004|CDS

ATGGTGCGGTTAGGGTTTGAATCAAGTCGATGCCTCATTTTTTTGCTTCTTTGTCGATTGAAATTGATTTTCGCTGAAGAGTTCATCGCTTCTATGGCTCTAATGTTGAAGTTTATCACTGATCAAGGACAGAAGGAGAAAAAAAACTTGGGAGTGAAAAATTTAAAAGTTGATAAAATCGACTGGAAAATTGATCGAAACGAGGACGTTGGGCCTCTCGCCGGAGTATTGGTTGCTATCAAAGACAACATTTGCACCGC...

Protein

Download Protein FASTA

193 aa · LXL04_008424|LXL04_008424|OH1004|PROTEIN

MVRLGFESSRCLIFLLLCRLKLIFAEEFIASMALMLKFITDQGQKEKKNLGVKNLKVDKIDWKIDRNEDVGPLAGVLVAIKDNICTADMPSTAGSKIFFHPSMAMINSMPSVAKEVVLSIRGAISHMEELGCIVTEVLLPSFSLGLPAYYVLTSFESYSNLYHRLHLRLHFPEQTVDGVGANESIQQPVENID

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008424`
TK1151 ID	TkA03G373120
OH-1004 ID	LXL04_008424
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	89.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008424

Location Chr02:99306958-99308313 (-)

Description Similar to GATA: Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q25A68`	Catalytic subunit of the mitochondrial Glu-tRNA(Gln) amidotransferase complex GatCAB.	No verified direct reference in this release
`Os04g0643200`	Catalytic subunit of the mitochondrial Glu-tRNA(Gln) amidotransferase complex GatCAB.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008424 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032543 mitochondrial translation Biological Process

GO:0070681 glutaminyl-tRNAGln biosynthesis via transamidation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0030956 glutamyl-tRNA(Gln) amidotransferase complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Molecular Function

GO:0050567 glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity Molecular Function

KEGG gene cross-reference

sbi:8079563

vvi:100247231

zma:100280064

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.326

Rank 1 · LXL04_008424 · OH-1004

Cytoplasm0.326

Rank 2 · LXL04_008424 · OH-1004

Cell membrane0.164

Rank 3 · LXL04_008424 · OH-1004

Mitochondrion0.139

Rank 4 · LXL04_008424 · OH-1004

Plastid0.101

Rank 5 · LXL04_008424 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01425.27Amidase59-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008424	`PF01425.27`	Amidase	59	98	6.3e-12	46.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q25A68`	Oryza sativa subsp. indica	Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial	62.000%	Swiss-Prot	weak database homology
`Q7X8Z8`	Oryza sativa subsp. japonica	Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial	62.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card