LXL04_008152 | RubberDandelionOmics

Gene overview

LXL04_008152

Reference: OH-1004 Chr: Chr02 Coordinates: 89695429-89696549 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

369 bp · LXL04_008152|LXL04_008152|OH1004|cDNA

ATGGCATCACCCGACCTCAAATCCACCGCCTTGATGGAACAGATGAAAGCCCATCTTTCCACCGACGCAGGCAAAGCCATCACTAAGAAGATCGGACTCGTGTATCAAATTAATATCGCTCCCAAGAAACTTGGATTCAACGAGGAGATTTACGTTGTCGATCTCAAAAAAGGAGAGGTTGCAAAAGGTCCCTTTGAAGGTAAGCCAGATGCGACCTTTTCTTTCACTGATGAAGACTTCTTCAAAGTTGCCACTGGGAA...

CDS

Download CDS FASTA

369 bp · LXL04_008152|LXL04_008152|OH1004|CDS

ATGGCATCACCCGACCTCAAATCCACCGCCTTGATGGAACAGATGAAAGCCCATCTTTCCACCGACGCAGGCAAAGCCATCACTAAGAAGATCGGACTCGTGTATCAAATTAATATCGCTCCCAAGAAACTTGGATTCAACGAGGAGATTTACGTTGTCGATCTCAAAAAAGGAGAGGTTGCAAAAGGTCCCTTTGAAGGTAAGCCAGATGCGACCTTTTCTTTCACTGATGAAGACTTCTTCAAAGTTGCCACTGGGAA...

Protein

Download Protein FASTA

122 aa · LXL04_008152|LXL04_008152|OH1004|PROTEIN

MASPDLKSTALMEQMKAHLSTDAGKAITKKIGLVYQINIAPKKLGFNEEIYVVDLKKGEVAKGPFEGKPDATFSFTDEDFFKVATGKMNPQIAFMRGAMKVKGSLSAAQKFTPDIFPKPSKM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008152`
TK1151 ID	TkA03G275710
OH-1004 ID	LXL04_008152
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008152

Location Chr02:89695429-89696549 (+)

Description Similar to SCP2: Sterol carrier protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42890`	Enhances the transfer of lipids between membranes in vitro.	Arabidopsis sterol carrier protein-2 is required for normal development of seeds and seedlings.2008 · DOI: 10.1093/jxb/ern201

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008152 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0008209 androgen metabolic process Biological Process

GO:0008210 estrogen metabolic process Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009845 seed germination Biological Process

GO:0032365 intracellular lipid transport Biological Process

GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase Biological Process

KEGG gene cross-reference

ath:AT5G42890

ddi:DDB_G0291247

hsa:3295

mmu:15488

rno:79244

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.537

Rank 1 · LXL04_008152 · OH-1004

Peroxisome0.264

Rank 2 · LXL04_008152 · OH-1004

Mitochondrion0.131

Rank 3 · LXL04_008152 · OH-1004

Endoplasmic reticulum0.121

Rank 4 · LXL04_008152 · OH-1004

Nucleus0.114

Rank 5 · LXL04_008152 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02036.23SCP213-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008152	`PF02036.23`	SCP2	13	112	2.6e-18	67.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMN0`	Arabidopsis thaliana	Sterol carrier protein 2	78.049%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card