LXL04_007663 | RubberDandelionOmics

Gene overview

LXL04_007663

Reference: OH-1004 Chr: Chr02 Coordinates: 55615890-55617135 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

834 bp · LXL04_007663|LXL04_007663|OH1004|cDNA

ATGGCGGCCCCGAGGAATCTCGTAGTGGAGACTGCAAGGTTGATGAAAGATGAGGAGACTGCCGAAGATTCGCCTACGAGTAAGAAGCCTGTAGGTGCCAAATTGGACGGGAGGTTTCCGCTGACGGGATGGGAATTCACGGTGGCGTTTAGTGTTTTCCTGGTGTTTTCCATGGGGTTGTTTTGCATTTATCTCACAATGCCAGCTGCTGAGTATGGCCGACTTAAGCTGCCGCGCTCCATTTCGGATCTGAAAATGCT...

CDS

Download CDS FASTA

834 bp · LXL04_007663|LXL04_007663|OH1004|CDS

ATGGCGGCCCCGAGGAATCTCGTAGTGGAGACTGCAAGGTTGATGAAAGATGAGGAGACTGCCGAAGATTCGCCTACGAGTAAGAAGCCTGTAGGTGCCAAATTGGACGGGAGGTTTCCGCTGACGGGATGGGAATTCACGGTGGCGTTTAGTGTTTTCCTGGTGTTTTCCATGGGGTTGTTTTGCATTTATCTCACAATGCCAGCTGCTGAGTATGGCCGACTTAAGCTGCCGCGCTCCATTTCGGATCTGAAAATGCT...

Protein

Download Protein FASTA

277 aa · LXL04_007663|LXL04_007663|OH1004|PROTEIN

MAAPRNLVVETARLMKDEETAEDSPTSKKPVGAKLDGRFPLTGWEFTVAFSVFLVFSMGLFCIYLTMPAAEYGRLKLPRSISDLKMLKDDLGTYATIYPTKFILGYCSTYIFMQTFMIPGTIFMSLLAGALFGVKGIFLVVFNATAGASSCYFLSKLIGRPIVSWLWPEKLKFFQTEIAKRGDKLLNYMLFLRITPTLPNLFINLASPIVDIPFHVFFLATVVGIIPASYITVRAGLALGDLKSVKDLYDLKTLSVLFLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007663`
TK1151 ID	TkA03G203130
OH-1004 ID	LXL04_007663
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007663

Location Chr02:55615890-55617135 (+)

Description Similar to At4g09580: Uncharacterized membrane protein At4g09580

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g09580`	Uncharacterized membrane protein At4g09580.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007663 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0044233 mitochondria-associated endoplasmic reticulum membrane contact site Cellular Component

GO:0017128 phospholipid scramblase activity Molecular Function

KEGG gene cross-reference

ath:AT4G09580

ddi:DDB_G0275543

dme:Dmel_CG8408

gga:423047

xla:495477

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.394

Rank 1 · LXL04_007663 · OH-1004

Golgi apparatus0.301

Rank 2 · LXL04_007663 · OH-1004

Cytoplasm0.104

Rank 3 · LXL04_007663 · OH-1004

Cell membrane0.103

Rank 4 · LXL04_007663 · OH-1004

Lysosome / Vacuole0.089

Rank 5 · LXL04_007663 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09335.17VTT_dom118-236 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007663	`PF09335.17`	VTT_dom	118	236	5.1e-15	56.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L586`	Arabidopsis thaliana	Uncharacterized membrane protein At4g09580	73.883%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card