LXL04_007622 | RubberDandelionOmics

Gene overview

LXL04_007622

Reference: OH-1004 Chr: Chr02 Coordinates: 54362832-54365668 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1488 bp · LXL04_007622|LXL04_007622|OH1004|cDNA

ATGGAGTTCAAAGATTCGATTTCTGGCGCTTTTGCATCGTGCATTGAAAGGCAAAAGACTGCCAAACCTTCTGTAATCGTGATAGGAAGTGGGATTTCGGGAATAGCTGCTGCTCATGTACTCAATAATGCTGATTTTGAGGTGGTACCATTACTACACAGGTTGTGTTATTGGAATCCCGGGATAGAATTGGTGGTCGCATTCACACTGATTACTCATTTGGTTGTCCGGTCGATATGGGAGCATCATGGCAAGTTACA...

CDS

Download CDS FASTA

1488 bp · LXL04_007622|LXL04_007622|OH1004|CDS

ATGGAGTTCAAAGATTCGATTTCTGGCGCTTTTGCATCGTGCATTGAAAGGCAAAAGACTGCCAAACCTTCTGTAATCGTGATAGGAAGTGGGATTTCGGGAATAGCTGCTGCTCATGTACTCAATAATGCTGATTTTGAGGTGGTACCATTACTACACAGGTTGTGTTATTGGAATCCCGGGATAGAATTGGTGGTCGCATTCACACTGATTACTCATTTGGTTGTCCGGTCGATATGGGAGCATCATGGCAAGTTACA...

Protein

Download Protein FASTA

495 aa · LXL04_007622|LXL04_007622|OH1004|PROTEIN

MEFKDSISGAFASCIERQKTAKPSVIVIGSGISGIAAAHVLNNADFEVVPLLHRLCYWNPGIELVVAFTLITHLVVRSIWEHHGKLHGVCNENPLAPLIRRLGLALYRTSGDNSVLYDHDLESYMLFDKEGHQVPQQMVIEVGEAFKKILKETEKVRDENQDDLSVLQAISVVLGRHPELRQEGLAYEVLQWYICRMEAWFAADLDMISLKNWDEENVLTGGHGLMVEGYYPVLKALSKDIDIRLNHRVTKIWNGPTDVM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007622`
TK1151 ID	TkA03G197620
OH-1004 ID	LXL04_007622
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.400
Protein coverage (%)	TK1151 96.401 / OH-1004 77.374 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007622

Location Chr02:54362832-54365668 (+)

Description Similar to PAO4: Probable polyamine oxidase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65840`	Flavoenzyme involved in polyamine back-conversion.	A putative peroxisomal polyamine oxidase, AtPAO4, is involved in polyamine catabolism in Arabidopsis thaliana.2008 · DOI: 10.1093/pcp/pcn114 Characterization of five polyamine oxidase isoforms in Arabidopsis thaliana.2010 · DOI: 10.1007/s00299-010-0881-1 Functional diversity inside the Arabidopsis polyamine oxidase gene family.2011 · DOI: 10.1093/jxb/erq341 Global Metabolic Profiling of Arabidopsis Polyamine Oxidase 4 (AtPAO4) Loss-of-Function Mutants Exhibiting Delayed Dark-Induced Senescence.2016 · DOI: 10.3389/fpls.2016.00173
`At3g59050`	Flavoenzyme involved in polyamine back-conversion.	Bridging the gap between plant and mammalian polyamine catabolism: a novel peroxisomal polyamine oxidase responsible for a full back-conversion pathway in Arabidopsis.2008 · DOI: 10.1104/pp.108.123802 Characterization of five polyamine oxidase isoforms in Arabidopsis thaliana.2010 · DOI: 10.1007/s00299-010-0881-1 Spermidine oxidase-derived H₂O₂ regulates pollen plasma membrane hyperpolarization-activated Ca(2+) -permeable channels and pollen tube growth.2010 · DOI: 10.1111/j.1365-313x.2010.04301.x Functional diversity inside the Arabidopsis polyamine oxidase gene family.2011 · DOI: 10.1093/jxb/erq341

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0671300`	Flavoenzyme involved in polyamine back-conversion.	Constitutively and highly expressed Oryza sativa polyamine oxidases localize in peroxisomes and catalyze polyamine back conversion.2012 · DOI: 10.1007/s00726-011-1002-3 Involvement of Polyamine Oxidase-Produced Hydrogen Peroxide during Coleorhiza-Limited Germination of Rice Seeds.2016 · DOI: 10.3389/fpls.2016.01219
`Os04g0671200`	Flavoenzyme involved in polyamine back-conversion.	Constitutively and highly expressed Oryza sativa polyamine oxidases localize in peroxisomes and catalyze polyamine back conversion.2012 · DOI: 10.1007/s00726-011-1002-3
`Os04g0623300`	Flavoenzyme involved in polyamine back-conversion.	Constitutively and highly expressed Oryza sativa polyamine oxidases localize in peroxisomes and catalyze polyamine back conversion.2012 · DOI: 10.1007/s00726-011-1002-3

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007622 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006598 polyamine catabolic process Biological Process

GO:0046203 spermidine catabolic process Biological Process

GO:0046208 spermine catabolic process Biological Process

GO:1903602 thermospermine catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0046592 polyamine oxidase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

GO:0052900 spermine oxidase (propane-1,3-diamine-forming) activity Molecular Function

GO:0052901 spermine oxidase activity Molecular Function

GO:0052903 N(1)-acetylpolyamine oxidase (3-acetamidopropanal-forming) activity Molecular Function

GO:1990534 thermospermine oxidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G65840

ath:AT3G59050

dosa:Os04g0623300

dosa:Os04g0671200

dosa:Os04g0671300

osa:4337046

osa:4337360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.368

Rank 1 · LXL04_007622 · OH-1004

Cytoplasm0.310

Rank 2 · LXL04_007622 · OH-1004

Mitochondrion0.141

Rank 3 · LXL04_007622 · OH-1004

Nucleus0.105

Rank 4 · LXL04_007622 · OH-1004

Extracellular0.083

Rank 5 · LXL04_007622 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01593.31Amino_oxidase87-459 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007622	`PF01593.31`	Amino_oxidase	87	459	2.1e-66	225.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H191`	Arabidopsis thaliana	Probable polyamine oxidase 4	63.052%	Swiss-Prot	strong database homology
`Q9LYT1`	Arabidopsis thaliana	Polyamine oxidase 3	59.623%	Swiss-Prot	strong database homology
`Q0J954`	Oryza sativa subsp. japonica	Polyamine oxidase 5	63.804%	Swiss-Prot	strong database homology
`Q7XR46`	Oryza sativa subsp. japonica	Polyamine oxidase 4	59.465%	Swiss-Prot	strong database homology
`Q7X809`	Oryza sativa subsp. japonica	Polyamine oxidase 3	56.341%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card