LXL04_007557 | RubberDandelionOmics

Gene overview

LXL04_007557

Reference: OH-1004 Chr: Chr02 Coordinates: 51945013-51946818 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

984 bp · LXL04_007557|LXL04_007557|OH1004|cDNA

ATGTCTGCATCCTCAAAATTCAGGAATAATACAGAGAAACGTACGAATAAAAAGGAGAGGGCCAAGGAGCGTAGAGAGAATCGTCACCAAGAGATCTCTCGCCTCCGTACCATTCCTTATTCAGACCACGAGAGgtggtggTCTGCAGAAACAATAGCGGCAGTGACCGGAGCTAATCCAGGAATTGGATTTGAGATTGCACGCCAGCTTGCATCACATGGATTGACAGTCATTCTTACTTCAAGAGACGCTACTCTAGG...

CDS

Download CDS FASTA

984 bp · LXL04_007557|LXL04_007557|OH1004|CDS

ATGTCTGCATCCTCAAAATTCAGGAATAATACAGAGAAACGTACGAATAAAAAGGAGAGGGCCAAGGAGCGTAGAGAGAATCGTCACCAAGAGATCTCTCGCCTCCGTACCATTCCTTATTCAGACCACGAGAGGTGGTGGTCTGCAGAAACAATAGCGGCAGTGACCGGAGCTAATCCAGGAATTGGATTTGAGATTGCACGCCAGCTTGCATCACATGGATTGACAGTCATTCTTACTTCAAGAGACGCTACTCTAGG...

Protein

Download Protein FASTA

327 aa · LXL04_007557|LXL04_007557|OH1004|PROTEIN

MSASSKFRNNTEKRTNKKERAKERRENRHQEISRLRTIPYSDHERWWSAETIAAVTGANPGIGFEIARQLASHGLTVILTSRDATLGEEATKALQEQGLKAVFHQLDVSDHESIDTFCACVKEKYGGLDILINNAGISHIIGSENSVEFAEKVININYIGTKNMIKSALPLMKPSSEGARIVNVRSRLGRLNGRRNRIADVGLRQKLEDPELLSEDVIDATMNKFLEEVKDGSWISGGWPQNNTDYSLSKLAVNCYTRVM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007557`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_007557`
Location	Chr02:51945013-51946818 (+)
Description	Similar to CBR1: Carbonyl reductase [NADPH] 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007557` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006629 lipid metabolic process Biological Process GO:0006706 steroid catabolic process Biological Process GO:0006805 xenobiotic metabolic process Biological Process GO:0008211 glucocorticoid metabolic process Biological Process GO:0032355 response to estradiol Biological Process GO:0032570 response to progesterone Biological Process GO:0042373 vitamin K metabolic process Biological Process GO:0042376 phylloquinone catabolic process Biological Process GO:0046457 prostanoid biosynthetic process Biological Process GO:1905344 prostaglandin catabolic process Biological Process GO:2000379 positive regulation of reactive oxygen species metabolic process Biological Process GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	hsa:873 mmu:12408 ssc:397143 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.634

Rank 1 · LXL04_007557 · OH-1004

Nucleus0.249

Rank 2 · LXL04_007557 · OH-1004

Mitochondrion0.136

Rank 3 · LXL04_007557 · OH-1004

Peroxisome0.098

Rank 4 · LXL04_007557 · OH-1004

Cell membrane0.072

Rank 5 · LXL04_007557 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short52-191 aa

PF01370.28Epimerase54-169 aa

PF08659.17KR55-138 aa

PF13561.13adh_short_C258-187 aa

PF13561.13adh_short_C2238-288 aa

PF00106.32adh_short243-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007557	`PF00106.32`	adh_short	52	191	3.3e-40	138.4
LXL04_007557	`PF01370.28`	Epimerase	54	169	3.3e-07	30.7
LXL04_007557	`PF08659.17`	KR	55	138	7.4e-09	36.5
LXL04_007557	`PF13561.13`	adh_short_C2	58	187	1e-30	107.8
LXL04_007557	`PF13561.13`	adh_short_C2	238	288	1e-30	107.8
LXL04_007557	`PF00106.32`	adh_short	243	288	3.3e-40	138.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card