LXL04_007551 | RubberDandelionOmics

Gene overview

LXL04_007551

Reference: OH-1004 Chr: Chr02 Coordinates: 51857411-51859000 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1041 bp · LXL04_007551|LXL04_007551|OH1004|cDNA

ATGGATTTAGATGAATTCAGGGCGATTTTATCAAATTCAAGGGTAGATGTTTGGGAAATTATTGATGCGGCTATAACCGTAGCTTCAACGGATTATATCGGGGAGCTTAAGCATCGTAGAGATGGAATCGTGGAGCGGCTATACACGCAGCAGTGTAATAATTGCGACGTGAATCTAATTGAGCAGCCGCCGAATGTTGGTGCAGTCCGGTCAATTGCAAAACCGGTAGATGATGATGACTTCAGAGGAGGAGGAGCTGA...

CDS

Download CDS FASTA

1041 bp · LXL04_007551|LXL04_007551|OH1004|CDS

ATGGATTTAGATGAATTCAGGGCGATTTTATCAAATTCAAGGGTAGATGTTTGGGAAATTATTGATGCGGCTATAACCGTAGCTTCAACGGATTATATCGGGGAGCTTAAGCATCGTAGAGATGGAATCGTGGAGCGGCTATACACGCAGCAGTGTAATAATTGCGACGTGAATCTAATTGAGCAGCCGCCGAATGTTGGTGCAGTCCGGTCAATTGCAAAACCGGTAGATGATGATGACTTCAGAGGAGGAGGAGCTGA...

Protein

Download Protein FASTA

346 aa · LXL04_007551|LXL04_007551|OH1004|PROTEIN

MDLDEFRAILSNSRVDVWEIIDAAITVASTDYIGELKHRRDGIVERLYTQQCNNCDVNLIEQPPNVGAVRSIAKPVDDDDFRGGGADSPLSPQSIPHDDEDEDEPDPYGGLLDDEQAKILRIKEQLEDPHQTDDAVVDLLQTLADMNLTFTGLKETDIGRHVNQLRKHPSNEVRGLVKQLVRKWKDLVDEWVGSNRGDRAPATLTDGDSPLMHNAPRSSLNGHHQGPDFGYSPNPHNGSSGSEPEQQRPKPLVSKKPAPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007551`
TK1151 ID	TkA03G189570
OH-1004 ID	LXL04_007551
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007551

Location Chr02:51857411-51859000 (+)

Description Similar to MED26C: Probable mediator of RNA polymerase II transcription subunit 26c

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09850`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release
`At5g05140`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release
`At3g10820`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007551 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006368 transcription elongation by RNA polymerase II Biological Process

GO:0010467 gene expression Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003711 transcription elongation factor activity Molecular Function

GO:0003746 translation elongation factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G10820

ath:AT5G05140

ath:AT5G09850

bta:533803

mmu:21401

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.594

Rank 1 · LXL04_007551 · OH-1004

Cytoplasm0.430

Rank 2 · LXL04_007551 · OH-1004

Cell membrane0.099

Rank 3 · LXL04_007551 · OH-1004

Endoplasmic reticulum0.058

Rank 4 · LXL04_007551 · OH-1004

Golgi apparatus0.029

Rank 5 · LXL04_007551 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08711.17Med26138-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007551	`PF08711.17`	Med26	138	188	1.4e-15	57.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KFC7`	Arabidopsis thaliana	Probable mediator of RNA polymerase II transcription subunit 26c	46.883%	Swiss-Prot	moderate database homology
`Q9FHK9`	Arabidopsis thaliana	Probable mediator of RNA polymerase II transcription subunit 26b	28.212%	Swiss-Prot	weak database homology
`F4J4Y5`	Arabidopsis thaliana	Probable mediator of RNA polymerase II transcription subunit 26a	28.788%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card