LXL04_007525 | RubberDandelionOmics

Gene overview

LXL04_007525

Reference: OH-1004 Chr: Chr02 Coordinates: 51259479-51262184 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

942 bp · LXL04_007525|LXL04_007525|OH1004|cDNA

ATGGGTAAATTGACTGGTGCAATAATAACCGGTTATATGATGTACTTGTATGAAGGGATCAAGAATGGAGGAAAAAAAGATCGGGTTTGTTTTGTGAGCCCGAGTTTGATTTCTAAAGATGGACGAGATCAGTATGATGTAAGAGAGCAGACAAAAGATAACGAgGTGAGGAACCTTGGTAAACCAGTTGAACTTGCTGGCCAGTATTACTTAGATGGAGCTGATGAGGTTAGTTTTTTGAATATCACCGGTTTTCGTGA...

CDS

Download CDS FASTA

942 bp · LXL04_007525|LXL04_007525|OH1004|CDS

ATGGGTAAATTGACTGGTGCAATAATAACCGGTTATATGATGTACTTGTATGAAGGGATCAAGAATGGAGGAAAAAAAGATCGGGTTTGTTTTGTGAGCCCGAGTTTGATTTCTAAAGATGGACGAGATCAGTATGATGTAAGAGAGCAGACAAAAGATAACGAGGTGAGGAACCTTGGTAAACCAGTTGAACTTGCTGGCCAGTATTACTTAGATGGAGCTGATGAGGTTAGTTTTTTGAATATCACCGGTTTTCGTGA...

Protein

Download Protein FASTA

313 aa · LXL04_007525|LXL04_007525|OH1004|PROTEIN

MGKLTGAIITGYMMYLYEGIKNGGKKDRVCFVSPSLISKDGRDQYDVREQTKDNEVRNLGKPVELAGQYYLDGADEVSFLNITGFRDFPLGDLPMLQILRYTSENVFVPLTVGGGIRDFTDANGRYYSSLEVALEYFRSGADKISIGSDAVYAAEEYLKTGAVVVSIDPRRQYLKSPDEVKFKAVKLQNLGPNGEEYAWYQCTVNGGREGRPIGAYELAKAVEELGAGEILLNCIDCDGQGKGFDIELIKLVSDAVGIPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007525`
TK1151 ID	TkA03G186630
OH-1004 ID	LXL04_007525
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.900
Protein coverage (%)	TK1151 96.241 / OH-1004 40.895 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007525

Location Chr02:51259479-51262184 (+)

Description Similar to HISN4: Imidazole glycerol phosphate synthase hisHF, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26900`	IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007525 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000105 L-histidine biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0000107 imidazoleglycerol-phosphate synthase activity Molecular Function

GO:0004359 glutaminase activity Molecular Function

GO:0016829 lyase activity Molecular Function

KEGG gene cross-reference

ani:ANIA_07430

ath:AT4G26900

mth:MTH_1343

sce:YBR248C

spo:2541224

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.519

Rank 1 · LXL04_007525 · OH-1004

Nucleus0.230

Rank 2 · LXL04_007525 · OH-1004

Plastid0.117

Rank 3 · LXL04_007525 · OH-1004

Extracellular0.108

Rank 4 · LXL04_007525 · OH-1004

Peroxisome0.071

Rank 5 · LXL04_007525 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00977.28His_biosynth51-295 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007525	`PF00977.28`	His_biosynth	51	295	1.2e-38	133.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ30`	Arabidopsis thaliana	Imidazole glycerol phosphate synthase hisHF, chloroplastic	79.931%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card