LXL04_007479 | RubberDandelionOmics

Gene overview

LXL04_007479

Reference: OH-1004 Chr: Chr02 Coordinates: 49722390-49730515 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6528 bp · LXL04_007479|LXL04_007479|OH1004|cDNA

ATGGCCGCCGCTGTAGGTTGGGCATATTCTTCCAGCAGTAATGGCAGCAGTCTTGCCACTAATGATCTGGGGAATGGAAACGGCTGGGCTATGGTTTATAACGTTTTGTTATATCTTCCTAGTGATGTTGACTCTACAGTTTCCAATTTCATGGCAGATAGAAATGGGGATAGACACCATGATATAGAACCTGCAACTCCAAAATCCATCATAAAGATGAGTTCAAGAGGGGGTAGTAACATGGAGGATCCCGATGGCAC...

CDS

Download CDS FASTA

6528 bp · LXL04_007479|LXL04_007479|OH1004|CDS

ATGGCCGCCGCTGTAGGTTGGGCATATTCTTCCAGCAGTAATGGCAGCAGTCTTGCCACTAATGATCTGGGGAATGGAAACGGCTGGGCTATGGTTTATAACGTTTTGTTATATCTTCCTAGTGATGTTGACTCTACAGTTTCCAATTTCATGGCAGATAGAAATGGGGATAGACACCATGATATAGAACCTGCAACTCCAAAATCCATCATAAAGATGAGTTCAAGAGGGGGTAGTAACATGGAGGATCCCGATGGCAC...

Protein

Download Protein FASTA

2175 aa · LXL04_007479|LXL04_007479|OH1004|PROTEIN

MAAAVGWAYSSSSNGSSLATNDLGNGNGWAMVYNVLLYLPSDVDSTVSNFMADRNGDRHHDIEPATPKSIIKMSSRGGSNMEDPDGTIASVAQCIEQLRQSSLSRQDKEYNLKQLLDLIDTRATAFSAVGSHSQAVPVLVSLLRSGSLGVKMQAATVLGSLCKENELRVKVLLGGCIPPLLGLLKSSSVEGRIAGAKTIYAVSQGGAKDHVGSKIFSTEGVVPVLWEQLEKGLKGGHLVDDLLTGSLRNLCSSTEGFWSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007479`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007479

Location Chr02:49722390-49730515 (-)

Description Similar to CSI1: Protein CELLULOSE SYNTHASE INTERACTIVE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22125`	Regulator of the microtubular cytoskeleton.	POM-POM2/cellulose synthase interacting1 is essential for the functional association of cellulose synthase and microtubules in Arabidopsis.2012 · DOI: 10.1105/tpc.111.093575 The Arabidopsis ARCP protein, CSI1, which is required for microtubule stability, is necessary for root and anther development.2012 · DOI: 10.1105/tpc.111.095059 Impaired cellulose synthase guidance leads to stem torsion and twists phyllotactic patterns in Arabidopsis.2013 · DOI: 10.1016/j.cub.2013.04.013 Cellulose synthase INTERACTIVE3 regulates cellulose biosynthesis in both a microtubule-dependent and microtubule-independent manner in Arabidopsis.2013 · DOI: 10.1105/tpc.113.116715 CESA TRAFFICKING INHIBITOR inhibits cellulose deposition and interferes with the trafficking of cellulose synthase complexes and their associated proteins KORRIGAN1 and POM2/CELLULOSE SYNTHASE INTERACTIVE PROTEIN1.2015 · DOI: 10.1104/pp.114.249003
`At1g77460`	Regulator of the microtubular cytoskeleton (By similarity).	Cellulose synthase INTERACTIVE3 regulates cellulose biosynthesis in both a microtubule-dependent and microtubule-independent manner in Arabidopsis.2013 · DOI: 10.1105/tpc.113.116715
`At1g44120`	Regulator of the microtubular cytoskeleton.	No verified direct reference in this release
`At2g23140`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At2g28830`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007479 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0034614 cellular response to reactive oxygen species Biological Process

GO:0042742 defense response to bacterium Biological Process

KEGG gene cross-reference

ath:AT1G44120

ath:AT1G77460

ath:AT2G22125

ath:AT2G23140

ath:AT2G28830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.442

Rank 1 · LXL04_007479 · OH-1004

Nucleus0.331

Rank 2 · LXL04_007479 · OH-1004

Cell membrane0.257

Rank 3 · LXL04_007479 · OH-1004

Endoplasmic reticulum0.066

Rank 4 · LXL04_007479 · OH-1004

Golgi apparatus0.056

Rank 5 · LXL04_007479 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25598.2ARM_PUB114-341 aa

PF00514.30Arm132-162 aa

PF24768.2ARM_ARMC5439-632 aa

PF25598.2ARM_PUB497-631 aa

PF00514.30Arm553-592 aa

PF24768.2ARM_ARMC51453-1615 aa

PF24768.2ARM_ARMC51726-1906 aa

PF24768.2ARM_ARMC51831-1993 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007479	`PF25598.2`	ARM_PUB	114	341	5.3e-23	82.6
LXL04_007479	`PF00514.30`	Arm	132	162	2.6e-48	161.3
LXL04_007479	`PF24768.2`	ARM_ARMC5	439	632	1.4e-41	143.6
LXL04_007479	`PF25598.2`	ARM_PUB	497	631	5.3e-23	82.6
LXL04_007479	`PF00514.30`	Arm	553	592	2.6e-48	161.3
LXL04_007479	`PF24768.2`	ARM_ARMC5	1453	1615	1.4e-41	143.6
LXL04_007479	`PF24768.2`	ARM_ARMC5	1726	1906	1.4e-41	143.6
LXL04_007479	`PF24768.2`	ARM_ARMC5	1831	1993	1.4e-41	143.6
LXL04_007479	`PF00168.37`	C2	2054	2144	1.6e-13	51.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IIM1`	Arabidopsis thaliana	Protein CELLULOSE SYNTHASE INTERACTIVE 1	75.925%	Swiss-Prot	strong database homology
`F4I718`	Arabidopsis thaliana	Protein CELLULOSE SYNTHASE INTERACTIVE 3	47.037%	Swiss-Prot	moderate database homology
`Q9C6Y4`	Arabidopsis thaliana	Protein CELLULOSE SYNTHASE INTERACTIVE 2	39.237%	Swiss-Prot	moderate database homology
`O22193`	Arabidopsis thaliana	U-box domain-containing protein 4	36.129%	Swiss-Prot	weak database homology
`Q9ZV31`	Arabidopsis thaliana	U-box domain-containing protein 12	32.474%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card