Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2340 bp · LXL04_007349|LXL04_007349|OH1004|cDNA
ATGATAAGGGGAGGAAAGAGCTTGGTTTCTTCACCACCTGCATTCTCAAACGATGCAAAACAACTTTTGGTTTGCACCGGAAATACCGTTTCCATTTTCAGCACCGCCACTGGTTTACAGGTATTGGAATTGGAAGGTCACACAGCACTAGTGACATCTATTATAGTCGTACCACCACCCACGCCTACAAGCAAGGTTTTATGCAATTGCTGGACAACTTCACTCGATGGTACTATCAAGTATTGGGATTTCTCTGGACC...
2340 bp · LXL04_007349|LXL04_007349|OH1004|CDS
ATGATAAGGGGAGGAAAGAGCTTGGTTTCTTCACCACCTGCATTCTCAAACGATGCAAAACAACTTTTGGTTTGCACCGGAAATACCGTTTCCATTTTCAGCACCGCCACTGGTTTACAGGTATTGGAATTGGAAGGTCACACAGCACTAGTGACATCTATTATAGTCGTACCACCACCCACGCCTACAAGCAAGGTTTTATGCAATTGCTGGACAACTTCACTCGATGGTACTATCAAGTATTGGGATTTCTCTGGACC...
Protein
Download Protein FASTA779 aa · LXL04_007349|LXL04_007349|OH1004|PROTEIN
MIRGGKSLVSSPPAFSNDAKQLLVCTGNTVSIFSTATGLQVLELEGHTALVTSIIVVPPPTPTSKVLCNCWTTSLDGTIKYWDFSGPELIKTINIQLPIYSMVIPSLLAQQSQYPSDIYAYISVKSQQKKQMKDLNGQILKCNLSKSRLIRGVLLSESKKPEKITISSTGKYFGIHEKRKLRIWEVPAKDNKHSTHRKLKLSHTKNMTCVAFHPTDRIVAAGDETGRILIWRGFGDRTFNYNNNNLGNGNNDYDEENPGV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_007349 |
|---|---|
| TK1151 ID | TkA03G161420 |
| OH-1004 ID | LXL04_007349 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_007349 |
|---|---|
| Location | Chr02:45194650-45197952 (+) |
| Description | Similar to wdr75: WD repeat-containing protein 75 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006364 rRNA processing Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0045943 positive regulation of transcription by RNA polymerase I Biological Process GO:2000234 positive regulation of rRNA processing Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0034455 t-UTP complex Cellular Component GO:0003723 RNA binding Molecular Function GO:0030515 snoRNA binding Molecular Function |
| KEGG gene cross-reference | dre:368478 hsa:84128 mmu:73674 spo:2542217 xla:446399 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25173.2Beta-prop_WDR3_1st4-94 aaPF23381.2Beta-prop_IFT122_1st14-104 aaPF23869.2Beta-prop_WDR75_1st15-237 aaPF24817.2WD40_WDHD1_1st15-228 aaPF23383.2Beta-prop_IFT140_1st163-235 aaPF23409.2Beta-prop_EML178-237 aaPF24105.2Beta-prop_CAF1B_HIR1179-380 aaPF24814.2WD40_Prp19193-359 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_007349 | PF25173.2 | Beta-prop_WDR3_1st | 4 | 94 | 4.8e-25 | 89.1 |
| LXL04_007349 | PF23381.2 | Beta-prop_IFT122_1st | 14 | 104 | 1.8e-28 | 100.3 |
| LXL04_007349 | PF23869.2 | Beta-prop_WDR75_1st | 15 | 237 | 4.2e-47 | 161.6 |
| LXL04_007349 | PF24817.2 | WD40_WDHD1_1st | 15 | 228 | 1.5e-24 | 87.5 |
| LXL04_007349 | PF23383.2 | Beta-prop_IFT140_1st | 163 | 235 | 1.1e-16 | 61.3 |
| LXL04_007349 | PF23409.2 | Beta-prop_EML | 178 | 237 | 9.3e-14 | 52.3 |
| LXL04_007349 | PF24105.2 | Beta-prop_CAF1B_HIR1 | 179 | 380 | 1.6e-11 | 44.5 |
| LXL04_007349 | PF24814.2 | WD40_Prp19 | 193 | 359 | 1.8e-24 | 87.0 |
| LXL04_007349 | PF24807.2 | WD40_CDC20-Fz | 195 | 307 | 6.3e-17 | 62.5 |
| LXL04_007349 | PF00400.39 | WD40 | 202 | 231 | 2.2e-22 | 79.2 |
| LXL04_007349 | PF23383.2 | Beta-prop_IFT140_1st | 266 | 307 | 1.1e-16 | 61.3 |
| LXL04_007349 | PF23869.2 | Beta-prop_WDR75_1st | 270 | 339 | 4.2e-47 | 161.6 |
| LXL04_007349 | PF23769.2 | Beta-prop_WDR75_2nd | 393 | 649 | 4.7e-30 | 105.2 |
| LXL04_007349 | PF24814.2 | WD40_Prp19 | 454 | 610 | 1.8e-24 | 87.0 |
| LXL04_007349 | PF25173.2 | Beta-prop_WDR3_1st | 470 | 595 | 4.8e-25 | 89.1 |
| LXL04_007349 | PF25174.2 | Beta-prop_THOC3 | 478 | 622 | 3.5e-27 | 95.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.