LXL04_007267 | RubberDandelionOmics

Gene overview

LXL04_007267

Reference: OH-1004 Chr: Chr02 Coordinates: 42065716-42067588 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

969 bp · LXL04_007267|LXL04_007267|OH1004|cDNA

ATGAAGTTTTCCGATCATTGGGTGAGAATCAGCATCGTATCTTGCCAGGGCAACTCGGAAGGCATCTCCGATTGGATGATGCAACCGTTGTTTGCAGCCATGGCGGGGTTGGATCCCCTTTTGACAATTCTGTCGTCTCAGAACAAGGTGACGATAACAAAATCAAAGGCCAAGCATCTGCGTCAACAACCAATACACTCGACAAATCGACTCCACTGTGTGTATCGAAACCCTATCAAAGATCGTCAAATTCATCGAAA...

CDS

Download CDS FASTA

969 bp · LXL04_007267|LXL04_007267|OH1004|CDS

ATGAAGTTTTCCGATCATTGGGTGAGAATCAGCATCGTATCTTGCCAGGGCAACTCGGAAGGCATCTCCGATTGGATGATGCAACCGTTGTTTGCAGCCATGGCGGGGTTGGATCCCCTTTTGACAATTCTGTCGTCTCAGAACAAGGTGACGATAACAAAATCAAAGGCCAAGCATCTGCGTCAACAACCAATACACTCGACAAATCGACTCCACTGTGTGTATCGAAACCCTATCAAAGATCGTCAAATTCATCGAAA...

Protein

Download Protein FASTA

322 aa · LXL04_007267|LXL04_007267|OH1004|PROTEIN

MKFSDHWVRISIVSCQGNSEGISDWMMQPLFAAMAGLDPLLTILSSQNKVTITKSKAKHLRQQPIHSTNRLHCVYRNPIKDRQIHRKRWSINEFTMAQTDTDFADCVELQPELKRLKLRRNNWDSDTFEFDEVLTEFASQKRVYEVVAKPVVENVLDGYNGTVMAYGQTGSIKVQIINSPYDEVATCLFNTRENKKSTKSYWFYVFNVPEIEQLDSLTARFIKEFDQVEEYSSKVIGSEFGIVPGSRDNSLYNALWVAQA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007267`
TK1151 ID	TkA03G592550
OH-1004 ID	LXL04_007267
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	78.400
Protein coverage (%)	TK1151 100.000 / OH-1004 59.938 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007267

Location Chr02:42065716-42067588 (+)

Description Similar to KU70: ATP-dependent DNA helicase 2 subunit KU70

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16970`	Single-stranded DNA-dependent ATP-dependent helicase.	Telomere length deregulation and enhanced sensitivity to genotoxic stress in Arabidopsis mutants deficient in Ku70.2002 · DOI: 10.1093/emboj/21.11.2819 Identification of Ku70 and Ku80 homologues in Arabidopsis thaliana: evidence for a role in the repair of DNA double-strand breaks.2002 · DOI: 10.1046/j.1365-313x.2002.01258.x Disruption of the Arabidopsis AtKu80 gene demonstrates an essential role for AtKu80 protein in efficient repair of DNA double-strand breaks in vivo.2002 · DOI: 10.1046/j.1365-313x.2002.01370.x Ku is required for telomeric C-rich strand maintenance but not for end-to-end chromosome fusions in Arabidopsis.2003 · DOI: 10.1073/pnas.0236128100
`At1g12430`	Kinesin-like protein KIN-UA.	No verified direct reference in this release
`At1g01950`	Involved in the control of epidermal-cell morphogenesis in roots and helical growth of roots by promoting microtubule depolymerization and limiting the accumulation of endoplasmic microtubules.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0184900`	Single-stranded DNA-dependent ATP-dependent helicase.	No verified direct reference in this release
`Os06g0137100`	Kinesin-like protein KIN-UB.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007267 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0006281 DNA repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006310 DNA recombination Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0009408 response to heat Biological Process

GO:0030705 cytoskeleton-dependent intracellular transport Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005871 kinesin complex Cellular Component

GO:0005874 microtubule Cellular Component

KEGG gene cross-reference

ath:AT1G01950

ath:AT1G12430

ath:AT1G16970

dosa:Os07g0184900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.390

Rank 1 · LXL04_007267 · OH-1004

Cytoplasm0.364

Rank 2 · LXL04_007267 · OH-1004

Cell membrane0.137

Rank 3 · LXL04_007267 · OH-1004

Mitochondrion0.124

Rank 4 · LXL04_007267 · OH-1004

Endoplasmic reticulum0.109

Rank 5 · LXL04_007267 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00225.30Kinesin108-173 aa

PF16796.12Microtub_bd108-198 aa

PF03731.22Ku_N172-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007267	`PF00225.30`	Kinesin	108	173	4.9e-16	59.3
LXL04_007267	`PF16796.12`	Microtub_bd	108	198	2.7e-07	31.3
LXL04_007267	`PF03731.22`	Ku_N	172	318	1.7e-27	97.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FQ08`	Arabidopsis thaliana	ATP-dependent DNA helicase 2 subunit KU70	64.238%	Swiss-Prot	weak database homology
`Q9FZ06`	Arabidopsis thaliana	Kinesin-like protein KIN-UA	89.189%	Swiss-Prot	weak database homology
`Q9LPC6`	Arabidopsis thaliana	Kinesin-like protein KIN-UB	77.647%	Swiss-Prot	weak database homology
`Q7F1M0`	Oryza sativa subsp. japonica	ATP-dependent DNA helicase 2 subunit KU70	59.477%	Swiss-Prot	weak database homology
`Q5VQ09`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-UB	85.333%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card