LXL04_007257 | RubberDandelionOmics

Gene overview

LXL04_007257

Reference: OH-1004 Chr: Chr02 Coordinates: 41550790-41551683 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

657 bp · LXL04_007257|LXL04_007257|OH1004|cDNA

ATGGACATGGAGGAAGGTTTGGTAATCAGAGGGAGGATTGAGATAGATTCACGACGGCCGTTCAAATCCGTTAAAGAGGCTGTCATGTTGTTCGGAGAAAAAGTCTTGGCCGGAGAGGTCTATGCCGGCCAGCAAATCAAACAGGCTGAGAGAATAGGAGGTGAAAGCAACGTCCACCATTACCGAACTAAAGTTGGCGCCATAGCAGCAGAGCTCGAAGAGACAAAACAAACCCTAGAAAAAGCAAAAGAGGAGGACAC...

CDS

Download CDS FASTA

657 bp · LXL04_007257|LXL04_007257|OH1004|CDS

ATGGACATGGAGGAAGGTTTGGTAATCAGAGGGAGGATTGAGATAGATTCACGACGGCCGTTCAAATCCGTTAAAGAGGCTGTCATGTTGTTCGGAGAAAAAGTCTTGGCCGGAGAGGTCTATGCCGGCCAGCAAATCAAACAGGCTGAGAGAATAGGAGGTGAAAGCAACGTCCACCATTACCGAACTAAAGTTGGCGCCATAGCAGCAGAGCTCGAAGAGACAAAACAAACCCTAGAAAAAGCAAAAGAGGAGGACAC...

Protein

Download Protein FASTA

218 aa · LXL04_007257|LXL04_007257|OH1004|PROTEIN

MDMEEGLVIRGRIEIDSRRPFKSVKEAVMLFGEKVLAGEVYAGQQIKQAERIGGESNVHHYRTKVGAIAAELEETKQTLEKAKEEDTCMAYYLASLKQELEETKSELKQLKSRKEELSPIDKEIKEIKLIERVEVNHHPDIEESSDEDDYVGLEKKRSVKFASPPSLTKVMIQAPEMQQTSPSLLKKKAQKKTLIPSLSGIFSRKKGGQSLRTPKSII

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007257`
TK1151 ID	TkA03G149930
OH-1004 ID	LXL04_007257
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.400
Protein coverage (%)	TK1151 96.296 / OH-1004 54.128 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007257

Location Chr02:41550790-41551683 (-)

Description Similar to At3g51220: WEB family protein At3g51220

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51220`	WEB family protein At3g51220.	No verified direct reference in this release
`At2g17940`	WEB family protein At2g17940.	No verified direct reference in this release
`At1g75720`	WEB family protein At1g75720.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007257 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G75720

ath:AT2G17940

ath:AT3G51220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.600

Rank 1 · LXL04_007257 · OH-1004

Nucleus0.304

Rank 2 · LXL04_007257 · OH-1004

Cytoplasm0.282

Rank 3 · LXL04_007257 · OH-1004

Endoplasmic reticulum0.047

Rank 4 · LXL04_007257 · OH-1004

Plastid0.038

Rank 5 · LXL04_007257 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05701.17WEMBL52-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007257	`PF05701.17`	WEMBL	52	118	5.6e-10	39.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD24`	Arabidopsis thaliana	WEB family protein At3g51220	36.585%	Swiss-Prot	moderate database homology
`O48822`	Arabidopsis thaliana	WEB family protein At2g17940	39.884%	Swiss-Prot	moderate database homology
`F4I0N3`	Arabidopsis thaliana	WEB family protein At1g75720	34.653%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card