LXL04_007248 | RubberDandelionOmics

Gene overview

LXL04_007248

Reference: OH-1004 Chr: Chr02 Coordinates: 41002126-41003236 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

498 bp · LXL04_007248|LXL04_007248|OH1004|cDNA

ATGTCGTCTACTTTCAGCGGCGATGAAACTGCTCCGTTCTTCGGCTTCCTAGGAGCCGCAGCAGCCCTCGTTTTCTCATGTATGGGAGCGGCGTATGGGACGGCGAAGAGTGGCGTTGGTGTTGCATCGATGGGAGTCATGAGGCCGGAGCTGGTTATGAAGTCGATTGTGCCGGTTGTTATGGCTGGAGTGTTAGGTATTTATGGATTGATTATTGCTGTTATTATTAGTACCGGAATCAATCCAAAGGCGAAATCGTA...

CDS

Download CDS FASTA

498 bp · LXL04_007248|LXL04_007248|OH1004|CDS

ATGTCGTCTACTTTCAGCGGCGATGAAACTGCTCCGTTCTTCGGCTTCCTAGGAGCCGCAGCAGCCCTCGTTTTCTCATGTATGGGAGCGGCGTATGGGACGGCGAAGAGTGGCGTTGGTGTTGCATCGATGGGAGTCATGAGGCCGGAGCTGGTTATGAAGTCGATTGTGCCGGTTGTTATGGCTGGAGTGTTAGGTATTTATGGATTGATTATTGCTGTTATTATTAGTACCGGAATCAATCCAAAGGCGAAATCGTA...

Protein

Download Protein FASTA

165 aa · LXL04_007248|LXL04_007248|OH1004|PROTEIN

MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007248`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007248

Location Chr02:41002126-41003236 (-)

Description Similar to V-type proton ATPase 16 kDa proteolipid subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19910`	Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007248 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000220 vacuolar proton-transporting V-type ATPase, V0 domain Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0033179 proton-transporting V-type ATPase, V0 domain Cellular Component

GO:0046961 proton-transporting ATPase activity, rotational mechanism Molecular Function

KEGG gene cross-reference

ath:AT1G19910

bvg:104884742

bvg:104887744

ghi:107903720

ghi:107909439

ghi:107920550

ghi:107936576

ghi:107949088

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.301

Rank 1 · LXL04_007248 · OH-1004

Lysosome / Vacuole0.297

Rank 2 · LXL04_007248 · OH-1004

Cell membrane0.250

Rank 3 · LXL04_007248 · OH-1004

Endoplasmic reticulum0.126

Rank 4 · LXL04_007248 · OH-1004

Golgi apparatus0.106

Rank 5 · LXL04_007248 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00137.27ATP-synt_C17-76 aa

PF00137.27ATP-synt_C97-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007248	`PF00137.27`	ATP-synt_C	17	76	8.6e-34	116.3
LXL04_007248	`PF00137.27`	ATP-synt_C	97	155	8.6e-34	116.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59228`	Arabidopsis thaliana	V-type proton ATPase subunit c2	98.788%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card