LXL04_007144 | RubberDandelionOmics

Gene overview

LXL04_007144

Reference: OH-1004 Chr: Chr02 Coordinates: 37287937-37291654 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2940 bp · LXL04_007144|LXL04_007144|OH1004|cDNA

ATGGCGTCTTCTTCAACTTCATCCATTCACAAGAGCTTCAAGTATGATGTGTTTTTGAGTTTTGGGGGCAAAGACACTCGTACCAACTTCGTTGATCATCTTTATTATGCTCTTCAGCAGAAAAGCATTCATACATACAAGGACGACGAGAGAATAAAAAAGGGCAAAAATATTAGTGATGAGCTCATCAGATCAATAGAAGACTCAAAGTTTTACATCATTGTTTTCTCCAAAAATTATGCCTCTTCCTCTTGGTGCTT...

CDS

Download CDS FASTA

2940 bp · LXL04_007144|LXL04_007144|OH1004|CDS

ATGGCGTCTTCTTCAACTTCATCCATTCACAAGAGCTTCAAGTATGATGTGTTTTTGAGTTTTGGGGGCAAAGACACTCGTACCAACTTCGTTGATCATCTTTATTATGCTCTTCAGCAGAAAAGCATTCATACATACAAGGACGACGAGAGAATAAAAAAGGGCAAAAATATTAGTGATGAGCTCATCAGATCAATAGAAGACTCAAAGTTTTACATCATTGTTTTCTCCAAAAATTATGCCTCTTCCTCTTGGTGCTT...

Protein

Download Protein FASTA

979 aa · LXL04_007144|LXL04_007144|OH1004|PROTEIN

MASSSTSSIHKSFKYDVFLSFGGKDTRTNFVDHLYYALQQKSIHTYKDDERIKKGKNISDELIRSIEDSKFYIIVFSKNYASSSWCLDELVKIIECHKTTEHTAYPIFYDVEPSEVRNQRGAVAEAFAKLEKEEAAGKWREALKEAANLAGWELKTTANGHEAKFIRKIVKELSLELRSIKFNTDENLVGMESRIKEVVSYLGSGLDDVHMIGIKGIGGGGKTTLVRAVFDQISFQFEGKSFVENVREVSNASLSGLKSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007144`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007144

Location Chr02:37287937-37291654 (+)

Description Similar to RPV1: Disease resistance protein RPV1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12010`	TIR-NB-LRR receptor-like protein involved in plant defense.	Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.2017 · DOI: 10.1016/j.chom.2017.03.005

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007144 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0050135 NADP+ nucleosidase activity Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.484

Rank 1 · LXL04_007144 · OH-1004

Nucleus0.286

Rank 2 · LXL04_007144 · OH-1004

Cell membrane0.246

Rank 3 · LXL04_007144 · OH-1004

Endoplasmic reticulum0.097

Rank 4 · LXL04_007144 · OH-1004

Extracellular0.051

Rank 5 · LXL04_007144 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582.26TIR14-183 aa

PF13676.12TIR_217-113 aa

PF00931.29NB-ARC195-364 aa

PF23282.2WHD_ROQ1433-504 aa

PF23598.2LRR_14772-900 aa

PF23952.2LRR_EndoS831-929 aa

PF23598.2LRR_14898-949 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007144	`PF01582.26`	TIR	14	183	1.1e-49	169.4
LXL04_007144	`PF13676.12`	TIR_2	17	113	6.7e-15	56.4
LXL04_007144	`PF00931.29`	NB-ARC	195	364	1.2e-19	71.2
LXL04_007144	`PF23282.2`	WHD_ROQ1	433	504	6.3e-16	59.0
LXL04_007144	`PF23598.2`	LRR_14	772	900	8.8e-18	64.9
LXL04_007144	`PF23952.2`	LRR_EndoS	831	929	5.5e-07	30.5
LXL04_007144	`PF23598.2`	LRR_14	898	949	8.8e-18	64.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ66`	Arabidopsis thaliana	Disease resistance-like protein DSC1	32.523%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card