LXL04_007086 | RubberDandelionOmics

Gene overview

LXL04_007086

Reference: OH-1004 Chr: Chr02 Coordinates: 35737453-35738374 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

816 bp · LXL04_007086|LXL04_007086|OH1004|cDNA

ATGCGTATGAGCTGCAATGGCTGCCGTGTTCTTCGAAAAGGTTGCAGTGAAAACTGCAGCATTAGACCTTGTTTGCAGTGGATCAAATCGCCGGAATCTCAAGCTAACGCCACCGTGTTTCTTGCGAAGTTTTACGGCCGTGCTGGACTTATGAATCTCATCAACGCCGGTCCTGAACACCTCCGTCCTGCGATATTCAGGTCACTTCTGTACGAGGCTTGTGGGCGGATTGTGAATCCGATTTACGGGTCTGTTGGGTT...

CDS

Download CDS FASTA

816 bp · LXL04_007086|LXL04_007086|OH1004|CDS

ATGCGTATGAGCTGCAATGGCTGCCGTGTTCTTCGAAAAGGTTGCAGTGAAAACTGCAGCATTAGACCTTGTTTGCAGTGGATCAAATCGCCGGAATCTCAAGCTAACGCCACCGTGTTTCTTGCGAAGTTTTACGGCCGTGCTGGACTTATGAATCTCATCAACGCCGGTCCTGAACACCTCCGTCCTGCGATATTCAGGTCACTTCTGTACGAGGCTTGTGGGCGGATTGTGAATCCGATTTACGGGTCTGTTGGGTT...

Protein

Download Protein FASTA

271 aa · LXL04_007086|LXL04_007086|OH1004|PROTEIN

MRMSCNGCRVLRKGCSENCSIRPCLQWIKSPESQANATVFLAKFYGRAGLMNLINAGPEHLRPAIFRSLLYEACGRIVNPIYGSVGLLWSGSWQLCQNAVEAVLHGSPITQIASDTAETNNGPPFKAYDIRHISKEDNSAGTNELHRVRTRCRFKRSASKDKASRVWIEVSGQNENNNDLSSHESALSHQSEAAHVVEGESREMAEESLASAETPLSNKEAENEPELDGKIELELTLGFEPVDKFKVKEATVAAAFDNSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007086`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007086

Location Chr02:35737453-35738374 (+)

Description Similar to LBD41: LOB domain-containing protein 41

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02550`	LOB domain-containing protein 41.	No verified direct reference in this release
`At1g67100`	LOB domain-containing protein 40.	No verified direct reference in this release
`At1g68510`	LOB domain-containing protein 42.	No verified direct reference in this release
`At3g49940`	LOB domain-containing protein 38.	No verified direct reference in this release
`At5g67420`	LOB domain-containing protein 37.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007086 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0060776 simple leaf morphogenesis Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001217 DNA-binding transcription repressor activity Molecular Function

KEGG gene cross-reference

ath:AT1G67100

ath:AT1G68510

ath:AT3G02550

ath:AT3G49940

ath:AT5G67420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.955

Rank 1 · LXL04_007086 · OH-1004

Cytoplasm0.102

Rank 2 · LXL04_007086 · OH-1004

Cell membrane0.032

Rank 3 · LXL04_007086 · OH-1004

Endoplasmic reticulum0.016

Rank 4 · LXL04_007086 · OH-1004

Plastid0.012

Rank 5 · LXL04_007086 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03195.20LOB4-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007086	`PF03195.20`	LOB	4	102	1.2e-23	84.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M886`	Arabidopsis thaliana	LOB domain-containing protein 41	61.200%	Swiss-Prot	strong database homology
`Q9ZW96`	Arabidopsis thaliana	LOB domain-containing protein 40	75.000%	Swiss-Prot	moderate database homology
`Q9CA30`	Arabidopsis thaliana	LOB domain-containing protein 42	69.231%	Swiss-Prot	moderate database homology
`Q9SN23`	Arabidopsis thaliana	LOB domain-containing protein 38	53.333%	Swiss-Prot	moderate database homology
`Q9FN11`	Arabidopsis thaliana	LOB domain-containing protein 37	64.545%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card