LXL04_007041 | RubberDandelionOmics

Gene overview

LXL04_007041

Reference: OH-1004 Chr: Chr02 Coordinates: 34246354-34247168 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

600 bp · LXL04_007041|LXL04_007041|OH1004|cDNA

ATGAAGAATCAGAGGACCATTGTAGTTGTTGTTTACATCAGAAACCCTAAAAAAATGGCCGATGGAGAAGAGGAGCTACCACGAGATGCCAAGATCGTCAAAACACTGCTAAAGTCAATGGGCGTTGACCACTACGAGCCTCGTGTAGTCCACCAGTTTCTAGAACTATGGTACCGCTACGTAGTCGATGTATTAACCGACGCACAAGTCTACTCAGAACATGCCGGAAAGTCAACCATTGACTCCGATGACGTCAAACT...

CDS

Download CDS FASTA

600 bp · LXL04_007041|LXL04_007041|OH1004|CDS

ATGAAGAATCAGAGGACCATTGTAGTTGTTGTTTACATCAGAAACCCTAAAAAAATGGCCGATGGAGAAGAGGAGCTACCACGAGATGCCAAGATCGTCAAAACACTGCTAAAGTCAATGGGCGTTGACCACTACGAGCCTCGTGTAGTCCACCAGTTTCTAGAACTATGGTACCGCTACGTAGTCGATGTATTAACCGACGCACAAGTCTACTCAGAACATGCCGGAAAGTCAACCATTGACTCCGATGACGTCAAACT...

Protein

Download Protein FASTA

199 aa · LXL04_007041|LXL04_007041|OH1004|PROTEIN

MKNQRTIVVVVYIRNPKKMADGEEELPRDAKIVKTLLKSMGVDHYEPRVVHQFLELWYRYVVDVLTDAQVYSEHAGKSTIDSDDVKLAIQSKVNFSFSQPPPREVLLELARNRNKIPLPKSISGPGMALPPDSDTLISPNYQLLIPRKRTSEVVEETEEDEEGSGDPKTNVSQEQRGDVAQNNNTQRVSFPIGGQKRSR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007041`
TK1151 ID	TkA03G105330
OH-1004 ID	LXL04_007041
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 90.955 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007041

Location Chr02:34246354-34247168 (-)

Description Similar to TAF9: Transcription initiation factor TFIID subunit 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54140`	TAFs are components of the transcription factor IID (TFIID) complex that is essential for mediating regulation of RNA polymerase transcription.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007041 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000492 box C/D snoRNP assembly Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006974 DNA damage response Biological Process

GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0042789 mRNA transcription by RNA polymerase II Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0050821 protein stabilization Biological Process

KEGG gene cross-reference

ath:AT1G54140

bta:532936

hsa:6880

mmu:108143

rno:373541

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.946

Rank 1 · LXL04_007041 · OH-1004

Cytoplasm0.174

Rank 2 · LXL04_007041 · OH-1004

Cell membrane0.018

Rank 3 · LXL04_007041 · OH-1004

Mitochondrion0.015

Rank 4 · LXL04_007041 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_007041 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02291.22TFIID-31kDa24-143 aa

PF15630.13CENP-S45-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007041	`PF02291.22`	TFIID-31kDa	24	143	9e-49	165.3
LXL04_007041	`PF15630.13`	CENP-S	45	89	1.5e-07	32.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYH2`	Arabidopsis thaliana	Transcription initiation factor TFIID subunit 9	81.061%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card