Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2121 bp · LXL04_006933|LXL04_006933|OH1004|cDNA
ATGCCAAGTATCAGAGCTCCAGCGACTAAGAAAGCAACAACTCTCACAGTTGCTGTAAAATGTAGGCCATTAACGGAGAAAGAGCGTGGCCGTGATATAGTGCGAGTGCATAATAATAAGGAGGTGGTTATTCTGGATCCGGACTTGTCAAAGGACTACCTAGATAGGATACAAAATCGAACAAAAGAGAGAAGATATACTTTTGATCATGCTTTTCCCCCGGACTCTAGCAATTCGGATGTCTATGAGAGAAGTATATC...
2121 bp · LXL04_006933|LXL04_006933|OH1004|CDS
ATGCCAAGTATCAGAGCTCCAGCGACTAAGAAAGCAACAACTCTCACAGTTGCTGTAAAATGTAGGCCATTAACGGAGAAAGAGCGTGGCCGTGATATAGTGCGAGTGCATAATAATAAGGAGGTGGTTATTCTGGATCCGGACTTGTCAAAGGACTACCTAGATAGGATACAAAATCGAACAAAAGAGAGAAGATATACTTTTGATCATGCTTTTCCCCCGGACTCTAGCAATTCGGATGTCTATGAGAGAAGTATATC...
Protein
Download Protein FASTA706 aa · LXL04_006933|LXL04_006933|OH1004|PROTEIN
MPSIRAPATKKATTLTVAVKCRPLTEKERGRDIVRVHNNKEVVILDPDLSKDYLDRIQNRTKERRYTFDHAFPPDSSNSDVYERSISSTISGVVNGLNATVFAYGSTGSGKTYTMVGTEGDPGLMVLSLHTIFNFIKNDKSSDEFEVTCSYLEVYNEVIYDLLEKSSGHLELREDPEQGIIVAGLRCIKVNSADRILELLNMGNSRRKTDSTDANETSSRSHAVLEITVIRKQKKKYRSQVIRGKLALVDLAGSERASET...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_006933 |
|---|---|
| TK1151 ID | TkA03G090830 |
| OH-1004 ID | LXL04_006933 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 99.693 / OH-1004 91.926Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_006933 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:30429699-30433837 (-) | ||||||||||||
| Description | Similar to KIN8B: Kinesin-like protein KIN-8B | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0007018 microtubule-based movement Biological Process GO:0060404 axonemal microtubule depolymerization Biological Process GO:0070462 plus-end specific microtubule depolymerization Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005871 kinesin complex Cellular Component GO:0005874 microtubule Cellular Component GO:0005929 cilium Cellular Component GO:0005930 axoneme Cellular Component GO:0003777 microtubule motor activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0008017 microtubule binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT3G49650 dosa:Os03g0773600 hsa:124602 mmu:286942 xla:373792 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00225.30Kinesin20-348 aaPF16796.12Microtub_bd43-163 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_006933 | PF00225.30 | Kinesin | 20 | 348 | 2.6e-112 | 375.7 |
| LXL04_006933 | PF16796.12 | Microtub_bd | 43 | 163 | 6.2e-23 | 82.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.