LXL04_006862 | RubberDandelionOmics

Gene overview

LXL04_006862

Reference: OH-1004 Chr: Chr02 Coordinates: 28280769-28283069 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1077 bp · LXL04_006862|LXL04_006862|OH1004|cDNA

ATGGTTGGCGCCGCGACGATGGCGACGGCGACGGCGACGCTTAAACTCCGACCACGCAGCCCCTCATCGATTTCCGGAAACTGCTGCTATACCCAGTCAGCACAACCCCTTCATCGCTCATTTCGCTATAACGCAGGTCGAAAACATTTCACATTGCGACCATCAAGATCATACACGACAAGTCTTCTATTCAACAGAAGAAACATAGAAGAAATAGAAAATGGGACACGTAAGCTGATAAAACCCGGGAAAGTATCCTC...

CDS

Download CDS FASTA

1077 bp · LXL04_006862|LXL04_006862|OH1004|CDS

ATGGTTGGCGCCGCGACGATGGCGACGGCGACGGCGACGCTTAAACTCCGACCACGCAGCCCCTCATCGATTTCCGGAAACTGCTGCTATACCCAGTCAGCACAACCCCTTCATCGCTCATTTCGCTATAACGCAGGTCGAAAACATTTCACATTGCGACCATCAAGATCATACACGACAAGTCTTCTATTCAACAGAAGAAACATAGAAGAAATAGAAAATGGGACACGTAAGCTGATAAAACCCGGGAAAGTATCCTC...

Protein

Download Protein FASTA

358 aa · LXL04_006862|LXL04_006862|OH1004|PROTEIN

MVGAATMATATATLKLRPRSPSSISGNCCYTQSAQPLHRSFRYNAGRKHFTLRPSRSYTTSLLFNRRNIEEIENGTRKLIKPGKVSSRSPVPDHILKPPYVGFKKPPGIASGPEIHDEKGIECMRASGRLAAQVLQYAGTLVKPGVTTDEIDKEVHKMIIENGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRELEDGDIINIDVTVYLNGYHGDTSATYLCGDVNEKAKNLVKVTKESLDKAISLCAPGVEFNKIGKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006862`
TK1151 ID	TkA03G082870
OH-1004 ID	LXL04_006862
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006862

Location Chr02:28280769-28283069 (+)

Description Similar to MAP1D: Methionine aminopeptidase 1D, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37040`	Removes the N-terminal methionine from nascent proteins.	No verified direct reference in this release
`At1g13270`	Removes the N-terminal methionine from nascent proteins.	No verified direct reference in this release
`At3g25740`	Removes the N-terminal methionine from nascent proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006862 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0016485 protein processing Biological Process

GO:0031365 N-terminal protein amino acid modification Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0004239 initiator methionyl aminopeptidase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0050897 cobalt ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G13270

ath:AT3G25740

ath:AT4G37040

mbo:BQ2027_MB2886C

mtu:Rv2861c

mtv:RVBD_2861c

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.879

Rank 1 · LXL04_006862 · OH-1004

Mitochondrion0.149

Rank 2 · LXL04_006862 · OH-1004

Cytoplasm0.023

Rank 3 · LXL04_006862 · OH-1004

Nucleus0.021

Rank 4 · LXL04_006862 · OH-1004

Cell membrane0.015

Rank 5 · LXL04_006862 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00557.30Peptidase_M24122-349 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006862	`PF00557.30`	Peptidase_M24	122	349	1.3e-52	179.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FV50`	Arabidopsis thaliana	Methionine aminopeptidase 1D, chloroplastic/mitochondrial	72.754%	Swiss-Prot	strong database homology
`Q9FV52`	Arabidopsis thaliana	Methionine aminopeptidase 1B, chloroplastic	62.162%	Swiss-Prot	strong database homology
`Q9FV51`	Arabidopsis thaliana	Methionine aminopeptidase 1C, chloroplastic/mitochondrial	56.386%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card