Gene Card
Gene overview
cDNA / CDS / Protein Sequences
351 bp · LXL04_006861|LXL04_006861|OH1004|cDNA
ATGGCGACTTGCACCACTTTTGAAGCTCTATCAGCTTTCGTCTGGAGAGCCAGAACCGAATCACTTCAAATGAAGCCAGATCAGAAAAGGAAACTCCTCTTTTCCGTAGACGGACGCTCCAGATTCGAACCGCAGTTGCCGGAAGGATACTCCGGCAATGGAATCGTTCTAACTGGCTCTATATGCAAGACTGGAGAACAAGTCGGGAATTCTTTGTCGTTCATGATGAAATTGATTCATGATACCGTGAAAATGGTTAC...
351 bp · LXL04_006861|LXL04_006861|OH1004|CDS
ATGGCGACTTGCACCACTTTTGAAGCTCTATCAGCTTTCGTCTGGAGAGCCAGAACCGAATCACTTCAAATGAAGCCAGATCAGAAAAGGAAACTCCTCTTTTCCGTAGACGGACGCTCCAGATTCGAACCGCAGTTGCCGGAAGGATACTCCGGCAATGGAATCGTTCTAACTGGCTCTATATGCAAGACTGGAGAACAAGTCGGGAATTCTTTGTCGTTCATGATGAAATTGATTCATGATACCGTGAAAATGGTTAC...
Protein
Download Protein FASTA116 aa · LXL04_006861|LXL04_006861|OH1004|PROTEIN
MATCTTFEALSAFVWRARTESLQMKPDQKRKLLFSVDGRSRFEPQLPEGYSGNGIVLTGSICKTGEQVGNSLSFMMKLIHDTVKMVTHGYMRSAIEHCFRIKLISFSSIKWLQIVT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_006861 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_006861 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:28058122-28058472 (+) | |||||||||
| Description | Similar to HHT1: Omega-hydroxypalmitate O-feruloyl transferase | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006084 acetyl-CoA metabolic process Biological Process GO:0007623 circadian rhythm Biological Process GO:0010345 suberin biosynthetic process Biological Process GO:0010597 green leaf volatile biosynthetic process Biological Process GO:0052325 cell wall pectin biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0090431 alkyl caffeate ester biosynthetic process Biological Process GO:0160181 piperine biosynthetic process Biological Process GO:1901787 benzoyl-CoA metabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0009536 plastid Cellular Component GO:0016746 acyltransferase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ag:AAN09796 ag:AAU06226 ath:AT5G41040 ath:AT5G63560 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02458.21Transferase5-99 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_006861 | PF02458.21 | Transferase | 5 | 99 | 5.8e-17 | 62.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.