LXL04_006751 | RubberDandelionOmics

Gene overview

LXL04_006751

Reference: OH-1004 Chr: Chr02 Coordinates: 24237529-24242816 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4026 bp · LXL04_006751|LXL04_006751|OH1004|cDNA

ATGGCGTCCACACTCTGTTTCACTCTTCTCATCTTTCTCTCTTCACTCTCACTTGTTTGCTCAGAGTACGTCTTACCGGACCGCTACTTCATCAACTGTGGATCACGATCTGATATTGATTTCACTGGCCGGAAATTCGTTGGCGACGTCAACCCCTCTGGTTTCTCCATCTCCGGTGGCCAAGTCGCCGCAGAAAACAACAACCCAGCAACAAACACGCCATCAATCTACAGAACAGCAAGAGTTTTCACAAAGAAATC...

CDS

Download CDS FASTA

4026 bp · LXL04_006751|LXL04_006751|OH1004|CDS

ATGGCGTCCACACTCTGTTTCACTCTTCTCATCTTTCTCTCTTCACTCTCACTTGTTTGCTCAGAGTACGTCTTACCGGACCGCTACTTCATCAACTGTGGATCACGATCTGATATTGATTTCACTGGCCGGAAATTCGTTGGCGACGTCAACCCCTCTGGTTTCTCCATCTCCGGTGGCCAAGTCGCCGCAGAAAACAACAACCCAGCAACAAACACGCCATCAATCTACAGAACAGCAAGAGTTTTCACAAAGAAATC...

Protein

Download Protein FASTA

1341 aa · LXL04_006751|LXL04_006751|OH1004|PROTEIN

MASTLCFTLLIFLSSLSLVCSEYVLPDRYFINCGSRSDIDFTGRKFVGDVNPSGFSISGGQVAAENNNPATNTPSIYRTARVFTKKSWYELEADEKNTFVMVHLHFSRFASTEFEFSNAKVDVSVAGFSLLSGFSIGNATVIREFIFPIGSNRRFKIVFTPSDGSSSAFVNAIEAFTTPSDLFTSGVSFPRISPAGENGDLEKLTSDYAFNPIHRVNVGGQAINVERDTLRRTWIPDDSFIFNNQSAKKVSFVGRVSYRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006751`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006751

Location Chr02:24237529-24242816 (-)

Description Similar to At2g23200: Probable receptor-like protein kinase At2g23200

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23200`	Probable receptor-like protein kinase At2g23200.	No verified direct reference in this release
`At5g24010`	Probable receptor-like protein kinase At5g24010.	No verified direct reference in this release
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At4g39110`	Probable receptor-like protein kinase At4g39110.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006751 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016324 apical plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G23200

ath:AT3G46290

ath:AT4G39110

ath:AT5G24010

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.531

Rank 1 · LXL04_006751 · OH-1004

Cytoplasm0.240

Rank 2 · LXL04_006751 · OH-1004

Nucleus0.148

Rank 3 · LXL04_006751 · OH-1004

Endoplasmic reticulum0.079

Rank 4 · LXL04_006751 · OH-1004

Golgi apparatus0.052

Rank 5 · LXL04_006751 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12819.14Malectin_like31-377 aa

PF07714.24PK_Tyr_Ser-Thr485-745 aa

PF00069.32Pkinase485-743 aa

PF03372.30Exo_endo_phos834-980 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006751	`PF12819.14`	Malectin_like	31	377	9.5e-21	75.1
LXL04_006751	`PF07714.24`	PK_Tyr_Ser-Thr	485	745	2.1e-47	162.3
LXL04_006751	`PF00069.32`	Pkinase	485	743	3.5e-43	148.6
LXL04_006751	`PF03372.30`	Exo_endo_phos	834	980	7.4e-06	26.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22187`	Arabidopsis thaliana	Probable receptor-like protein kinase At2g23200	41.901%	Swiss-Prot	moderate database homology
`Q9FLW0`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g24010	41.607%	Swiss-Prot	moderate database homology
`Q9FN92`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g59700	41.272%	Swiss-Prot	moderate database homology
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	40.695%	Swiss-Prot	moderate database homology
`Q9T020`	Arabidopsis thaliana	Probable receptor-like protein kinase At4g39110	42.167%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card