LXL04_006699 | RubberDandelionOmics

Gene overview

LXL04_006699

Reference: OH-1004 Chr: Chr02 Coordinates: 22507149-22508453 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1305 bp · LXL04_006699|LXL04_006699|OH1004|cDNA

ATGGGCCATCTCCTTCCGATGGCCGAATTCGCTAAAAGACTTGTCAAACACCACCCCATTTCGGTCACCATCTTCATTCCTACAACAGGAACTCTTCCTAAACCTCAAATATCCATTCTTGAATCATTGCCGGAAAACATACACCACTCGTTTCTTCCCTCAGTAAACATGGATCTCTTACCGGAAGGTTCACGCCCGGAGTTTGTAATTTCCTTCATCATGCAATCTAATCTTTCAAGTCTCCGAGATGCTTTAATTTC...

CDS

Download CDS FASTA

1305 bp · LXL04_006699|LXL04_006699|OH1004|CDS

ATGGGCCATCTCCTTCCGATGGCCGAATTCGCTAAAAGACTTGTCAAACACCACCCCATTTCGGTCACCATCTTCATTCCTACAACAGGAACTCTTCCTAAACCTCAAATATCCATTCTTGAATCATTGCCGGAAAACATACACCACTCGTTTCTTCCCTCAGTAAACATGGATCTCTTACCGGAAGGTTCACGCCCGGAGTTTGTAATTTCCTTCATCATGCAATCTAATCTTTCAAGTCTCCGAGATGCTTTAATTTC...

Protein

Download Protein FASTA

434 aa · LXL04_006699|LXL04_006699|OH1004|PROTEIN

MGHLLPMAEFAKRLVKHHPISVTIFIPTTGTLPKPQISILESLPENIHHSFLPSVNMDLLPEGSRPEFVISFIMQSNLSSLRDALISLKSRTNLVALVFDIFGHDSLEVAKELNLLNFLFFPSNAMVLSFTFMLQKLDEETSCEYKDLSDPVKVPGSVSFHGRDLIATVQIRTDEVYKSYLLLSKRLNFLDGIIVNSFHELEEETFRVLGAAGQSQTPIYPIGPLIQSATTIELEPHDCIKWLDNQPDRSVVLVSFGSGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006699`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006699

Location Chr02:22507149-22508453 (-)

Description Similar to AS: Hydroquinone glucosyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01070`	Bifunctional O-glycosyltransferase and N-glycosyltransferase that can detoxify xenobiotics.	Functional importance of the family 1 glucosyltransferase UGT72B1 in the metabolism of xenobiotics in Arabidopsis thaliana.2005 · DOI: 10.1111/j.1365-313x.2005.02398.x Characterization and engineering of the bifunctional N- and O-glucosyltransferase involved in xenobiotic metabolism in plants.2007 · DOI: 10.1073/pnas.0706421104
`At1g01420`	Possesses low quercetin 3-O-glucosyltransferase activity in vitro.	No verified direct reference in this release
`At1g01390`	UDP-glycosyltransferase 72B2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006699 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006805 xenobiotic metabolic process Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0042178 xenobiotic catabolic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0047213 anthocyanidin 3-O-glucosyltransferase activity Molecular Function

GO:0050505 hydroquinone glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:CAC35167

ath:AT1G01390

ath:AT1G01420

ath:AT4G01070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.800

Rank 1 · LXL04_006699 · OH-1004

Nucleus0.257

Rank 2 · LXL04_006699 · OH-1004

Peroxisome0.070

Rank 3 · LXL04_006699 · OH-1004

Endoplasmic reticulum0.057

Rank 4 · LXL04_006699 · OH-1004

Plastid0.049

Rank 5 · LXL04_006699 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201.25UDPGT235-380 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006699	`PF00201.25`	UDPGT	235	380	4.3e-21	76.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M156`	Arabidopsis thaliana	UDP-glycosyltransferase 72B1	48.478%	Swiss-Prot	moderate database homology
`Q9LNI1`	Arabidopsis thaliana	UDP-glycosyltransferase 72B3	46.370%	Swiss-Prot	moderate database homology
`Q8W4C2`	Arabidopsis thaliana	UDP-glycosyltransferase 72B2	47.307%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card