LXL04_006635 | RubberDandelionOmics

Gene overview

LXL04_006635

Reference: OH-1004 Chr: Chr02 Coordinates: 20413753-20417142 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1785 bp · LXL04_006635|LXL04_006635|OH1004|cDNA

ATGTCGAATGTCGAAGAAACTCATAAACAAGAAGAAAATCAAGAAGGGGAAGATGTCAAAGAACTTAGCTTCGAAGAGCTAGGATTAGACCCCCGTCTTATTCGTGCCCTTACGAAGAAGAATATCGAAAAACCCACTCCAATTCAGCAGACCGGCATTCCACTAATCCTCGAAGGGAAGGATGTGGTCGCACGAGCTAAAACCGGTTCCGGCAAAACATTCGCCTACTTGCTTCCGTTACTTCAGAAGCTCATATCGGA...

CDS

Download CDS FASTA

1785 bp · LXL04_006635|LXL04_006635|OH1004|CDS

ATGTCGAATGTCGAAGAAACTCATAAACAAGAAGAAAATCAAGAAGGGGAAGATGTCAAAGAACTTAGCTTCGAAGAGCTAGGATTAGACCCCCGTCTTATTCGTGCCCTTACGAAGAAGAATATCGAAAAACCCACTCCAATTCAGCAGACCGGCATTCCACTAATCCTCGAAGGGAAGGATGTGGTCGCACGAGCTAAAACCGGTTCCGGCAAAACATTCGCCTACTTGCTTCCGTTACTTCAGAAGCTCATATCGGA...

Protein

Download Protein FASTA

594 aa · LXL04_006635|LXL04_006635|OH1004|PROTEIN

MSNVEETHKQEENQEGEDVKELSFEELGLDPRLIRALTKKNIEKPTPIQQTGIPLILEGKDVVARAKTGSGKTFAYLLPLLQKLISDNNSSSSKPLAPTAMILVPSRELCQQVYSEVLSLIELCRVQLKVVQLTGEPSFSEMATALAGPPHIFVSTPACVQRCLSSGVLQAKSVHDSLSVLILDEADLLFTYGYEKNLKDLKTHIPKRCQCLLMSATSSDDVESLKKLYLHNPYILTLPEVGDGKDEIVPKNVQQFSIQC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006635`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006635

Location Chr02:20413753-20417142 (-)

Description Similar to RH16: DEAD-box ATP-dependent RNA helicase 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34910`	DEAD-box ATP-dependent RNA helicase 16.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0728800`	DEAD-box ATP-dependent RNA helicase 16.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006635 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003678 DNA helicase activity Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0033677 DNA/RNA helicase activity Molecular Function

KEGG gene cross-reference

act:ACLA_073630

aor:AO090026000163

ath:AT4G34910

dosa:Os03g0728800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.894

Rank 1 · LXL04_006635 · OH-1004

Cytoplasm0.150

Rank 2 · LXL04_006635 · OH-1004

Mitochondrion0.036

Rank 3 · LXL04_006635 · OH-1004

Cell membrane0.017

Rank 4 · LXL04_006635 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_006635 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270.36DEAD46-224 aa

PF00271.38Helicase_C273-337 aa

PF00271.38Helicase_C374-406 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006635	`PF00270.36`	DEAD	46	224	1.8e-37	129.3
LXL04_006635	`PF00271.38`	Helicase_C	273	337	5.6e-19	69.1
LXL04_006635	`PF00271.38`	Helicase_C	374	406	5.6e-19	69.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SW44`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 16	69.052%	Swiss-Prot	strong database homology
`Q6ATJ8`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 16	60.638%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card