LXL04_006582 | RubberDandelionOmics

Gene overview

LXL04_006582

Reference: OH-1004 Chr: Chr02 Coordinates: 14196006-14197606 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · LXL04_006582|LXL04_006582|OH1004|cDNA

ATGGGCAAGTCGACGGTGACGACGAAAGATGATGCGCAAGCTCTTTTCCGCTCTCTGCATTCTGCTTATTCAGCTATTCCCACTAATCTCAAGGTTCCTCTTTTCTCGATTCATCTAATTAAGTTCGTGCGTGTTTTGTGTTGTGCCTTAACAGCATCTGATAATTCGTCTCTTGGATTAGAAGCTCAACTTAGACAAGCTATTGCTAAGTCACAAGCAGAACTTGCTTCCATTTGTGCTTCATTAGGAGACCCATTTTT...

CDS

Download CDS FASTA

798 bp · LXL04_006582|LXL04_006582|OH1004|CDS

ATGGGCAAGTCGACGGTGACGACGAAAGATGATGCGCAAGCTCTTTTCCGCTCTCTGCATTCTGCTTATTCAGCTATTCCCACTAATCTCAAGGTTCCTCTTTTCTCGATTCATCTAATTAAGTTCGTGCGTGTTTTGTGTTGTGCCTTAACAGCATCTGATAATTCGTCTCTTGGATTAGAAGCTCAACTTAGACAAGCTATTGCTAAGTCACAAGCAGAACTTGCTTCCATTTGTGCTTCATTAGGAGACCCATTTTT...

Protein

Download Protein FASTA

265 aa · LXL04_006582|LXL04_006582|OH1004|PROTEIN

MGKSTVTTKDDAQALFRSLHSAYSAIPTNLKVPLFSIHLIKFVRVLCCALTASDNSSLGLEAQLRQAIAKSQAELASICASLGDPFLPIMQIESGSLTKELAAIFPQVEMMQKKKNERKVQFIEVLEQIQNLSKELSTSTEDKSCFPILDESDLSLRRLEELKIILHTLEKEKSDRLKKVMEYLASLDSLCGVLGMNVKNTIIGIHPNLENPGTKKSISLDTIERRMQRLSVKSANRNRDLIICKENVLKMKDYGKFRGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006582`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006582

Location Chr02:14196006-14197606 (+)

Description Similar to MAP65-3: 65-kDa microtubule-associated protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51600`	Microtubule-associated protein that plays a critical role in organizing the mitotic microtubule array during both early and late mitosis in all plant organs.	The plant microtubule-associated protein AtMAP65-3/PLE is essential for cytokinetic phragmoplast function.2004 · DOI: 10.1016/j.cub.2004.02.032 MAP65-3 microtubule-associated protein is essential for nematode-induced giant cell ontogenesis in Arabidopsis.2008 · DOI: 10.1105/tpc.107.057422
`At5g62250`	65-kDa microtubule-associated protein 9.	No verified direct reference in this release
`At5g55230`	Microtubule-associated protein that bundle and stabilize adjacent microtubules (MT) of the cell cortex.	In vivo dynamics and differential microtubule-binding activities of MAP65 proteins.2004 · DOI: 10.1104/pp.104.051623 Two microtubule-associated proteins of the Arabidopsis MAP65 family function differently on microtubules.2005 · DOI: 10.1104/pp.104.052456 Dynamic interaction of NtMAP65-1a with microtubules in vivo.2005 · DOI: 10.1242/jcs.02433 Modulated targeting of GFP-AtMAP65-1 to central spindle microtubules during division.2005 · DOI: 10.1111/j.1365-313x.2005.02464.x Control of the AtMAP65-1 interaction with microtubules through the cell cycle.2006 · DOI: 10.1242/jcs.03051 AtMAP65-1 binds to tubulin dimers to promote tubulin assembly.2007 · DOI: 10.5483/bmbrep.2007.40.2.218 Two microtubule-associated proteins of Arabidopsis MAP65s promote antiparallel microtubule bundling.2008 · DOI: 10.1091/mbc.e08-04-0341 Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746
`At1g14690`	65-kDa microtubule-associated protein 7.	No verified direct reference in this release
`At2g01910`	Microtubule-associated protein that mediates the formation of a mesh-like stable and dense network formed by individual microtubules (MT).	Two microtubule-associated proteins of the Arabidopsis MAP65 family function differently on microtubules.2005 · DOI: 10.1104/pp.104.052456

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006582 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000280 nuclear division Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0001578 microtubule bundle formation Biological Process

GO:0007020 microtubule nucleation Biological Process

GO:0009624 response to nematode Biological Process

GO:0031116 positive regulation of microtubule polymerization Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0046785 microtubule polymerization Biological Process

GO:0048528 post-embryonic root development Biological Process

GO:0051301 cell division Biological Process

GO:0052096 formation of syncytium involving giant cell for nutrient acquisition Biological Process

KEGG gene cross-reference

ath:AT1G14690

ath:AT2G01910

ath:AT5G51600

ath:AT5G55230

ath:AT5G62250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.525

Rank 1 · LXL04_006582 · OH-1004

Nucleus0.461

Rank 2 · LXL04_006582 · OH-1004

Mitochondrion0.075

Rank 3 · LXL04_006582 · OH-1004

Cell membrane0.045

Rank 4 · LXL04_006582 · OH-1004

Endoplasmic reticulum0.040

Rank 5 · LXL04_006582 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03999.18MAP65_ASE158-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006582	`PF03999.18`	MAP65_ASE1	58	223	1.1e-17	64.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHM4`	Arabidopsis thaliana	65-kDa microtubule-associated protein 3	41.081%	Swiss-Prot	moderate database homology
`Q4PSA3`	Arabidopsis thaliana	65-kDa microtubule-associated protein 9	38.506%	Swiss-Prot	moderate database homology
`Q9FLP0`	Arabidopsis thaliana	65-kDa microtubule-associated protein 1	38.922%	Swiss-Prot	moderate database homology
`Q8L836`	Arabidopsis thaliana	65-kDa microtubule-associated protein 7	38.953%	Swiss-Prot	moderate database homology
`Q9SIS3`	Arabidopsis thaliana	65-kDa microtubule-associated protein 6	37.234%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card