LXL04_006575 | RubberDandelionOmics

Gene overview

LXL04_006575

Reference: OH-1004 Chr: Chr02 Coordinates: 13662706-13664183 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

534 bp · LXL04_006575|LXL04_006575|OH1004|cDNA

ATGCGCAGATCAGGGGGTGTCGCTTGGCTGAATGCGGTGGTGTTACTGTTAATGGTGTTTGTGGCGGCGGCGATGATGACGTGCGTGATGTGTAGAAGTCCGGTGCGTCACCTCGTCGGCGGGAAGGAAATGTGGAAACCGAATTATAATTACACTGATTGGGCTCGTGAAGAGACGTTCTACGTCGGTGACTGGCTCTATTTTGTATACGACAAGCACATGTTCAACGTATTGGAGGTGAACGAAACCAGTTACAAAAA...

CDS

Download CDS FASTA

534 bp · LXL04_006575|LXL04_006575|OH1004|CDS

ATGCGCAGATCAGGGGGTGTCGCTTGGCTGAATGCGGTGGTGTTACTGTTAATGGTGTTTGTGGCGGCGGCGATGATGACGTGCGTGATGTGTAGAAGTCCGGTGCGTCACCTCGTCGGCGGGAAGGAAATGTGGAAACCGAATTATAATTACACTGATTGGGCTCGTGAAGAGACGTTCTACGTCGGTGACTGGCTCTATTTTGTATACGACAAGCACATGTTCAACGTATTGGAGGTGAACGAAACCAGTTACAAAAA...

Protein

Download Protein FASTA

177 aa · LXL04_006575|LXL04_006575|OH1004|PROTEIN

MRRSGGVAWLNAVVLLLMVFVAAAMMTCVMCRSPVRHLVGGKEMWKPNYNYTDWAREETFYVGDWLYFVYDKHMFNVLEVNETSYKNCTDQGFIFNISRGAGRDVFELKQPKPYYFLASGGYCYNGMKVAVKAVEFVQVPAPQPSPAKNGGNPITRISYPLISLIVIATWAVFIKYL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006575`
TK1151 ID	TkA03G049060
OH-1004 ID	LXL04_006575
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006575

Location Chr02:13662706-13664183 (+)

Description Similar to At5g15350: Lamin-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27035`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At5g15350`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At4g12880`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At3g01070`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At1g17800`	May act as a carbohydrate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006575 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0009055 electron transfer activity Molecular Function

KEGG gene cross-reference

ath:AT1G17800

ath:AT2G27035

ath:AT3G01070

ath:AT4G12880

ath:AT5G15350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.776

Rank 1 · LXL04_006575 · OH-1004

Cytoplasm0.078

Rank 2 · LXL04_006575 · OH-1004

Endoplasmic reticulum0.076

Rank 3 · LXL04_006575 · OH-1004

Extracellular0.073

Rank 4 · LXL04_006575 · OH-1004

Golgi apparatus0.046

Rank 5 · LXL04_006575 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02298.24Cu_bind_like45-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006575	`PF02298.24`	Cu_bind_like	45	127	3e-18	66.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IVN9`	Arabidopsis thaliana	Early nodulin-like protein 20	41.781%	Swiss-Prot	moderate database homology
`Q39131`	Arabidopsis thaliana	Early nodulin-like protein 17	37.647%	Swiss-Prot	moderate database homology
`Q9STZ8`	Arabidopsis thaliana	Early nodulin-like protein 19	45.082%	Swiss-Prot	moderate database homology
`Q9MAC1`	Arabidopsis thaliana	Early nodulin-like protein 16	43.810%	Swiss-Prot	moderate database homology
`Q9LMU7`	Arabidopsis thaliana	Early nodulin-like protein 22	34.921%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card