LXL04_006558 | RubberDandelionOmics

Gene overview

LXL04_006558

Reference: OH-1004 Chr: Chr02 Coordinates: 13426753-13428414 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1113 bp · LXL04_006558|LXL04_006558|OH1004|cDNA

ATGAACAAGTGTGAAGTGAAGGAACATTGGGGTATTGTTTACGTCCCAGATAAACCACCATTCCCTCTTCACCAACAACCCACCGTCAAAGTTCATGCTGCTGTAATTGATCCTAAACATGCCAACACTCTTGTCAGGAAATTGAATCAGATTTTGCCGTTAGAAAATCTGCGCCATGTGAAACGTGTTCGAAAGCAAGTTCTTGATGAagGAGGCATTCGATTATCAATGATGTTATGTTTAGCTGATGAAAGTGATGA...

CDS

Download CDS FASTA

1113 bp · LXL04_006558|LXL04_006558|OH1004|CDS

ATGAACAAGTGTGAAGTGAAGGAACATTGGGGTATTGTTTACGTCCCAGATAAACCACCATTCCCTCTTCACCAACAACCCACCGTCAAAGTTCATGCTGCTGTAATTGATCCTAAACATGCCAACACTCTTGTCAGGAAATTGAATCAGATTTTGCCGTTAGAAAATCTGCGCCATGTGAAACGTGTTCGAAAGCAAGTTCTTGATGAAGGAGGCATTCGATTATCAATGATGTTATGTTTAGCTGATGAAAGTGATGA...

Protein

Download Protein FASTA

370 aa · LXL04_006558|LXL04_006558|OH1004|PROTEIN

MNKCEVKEHWGIVYVPDKPPFPLHQQPTVKVHAAVIDPKHANTLVRKLNQILPLENLRHVKRVRKQVLDEGGIRLSMMLCLADESDDTQLEIIPQEIVDLINLYKLETFITKVCKYAPISKEEWIEQSKLWPTSYHPPTYNISGITGFSEEESLSVCTFMKQALDLSKCECQIVNAAIIVDPSTNYIIAHARDQVNSCSCFINHEHDVMVSCLNPWQWCNENSSSCSWHPLRHAAIVAIENSSERDRRLFPGSGLDESTD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006558`
TK1151 ID	TkA03G048130
OH-1004 ID	LXL04_006558
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006558

Location Chr02:13426753-13428414 (+)

Description Similar to TAD3: tRNA-specific adenosine deaminase TAD3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24670`	Involved in RNA editing.	Identification of enzymes for adenosine-to-inosine editing and discovery of cytidine-to-uridine editing in nucleus-encoded transfer RNAs of Arabidopsis.2014 · DOI: 10.1104/pp.114.250498

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006558 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006400 tRNA modification Biological Process

GO:0008033 tRNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003824 catalytic activity Molecular Function

GO:0008251 tRNA-specific adenosine deaminase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0052717 tRNA-specific adenosine-34 deaminase activity Molecular Function

KEGG gene cross-reference

ath:AT5G24670

hsa:113179

mmu:100113398

rno:100125374

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.553

Rank 1 · LXL04_006558 · OH-1004

Cytoplasm0.472

Rank 2 · LXL04_006558 · OH-1004

Mitochondrion0.107

Rank 3 · LXL04_006558 · OH-1004

Cell membrane0.036

Rank 4 · LXL04_006558 · OH-1004

Endoplasmic reticulum0.028

Rank 5 · LXL04_006558 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30953.1TAD3_N29-131 aa

PF00383.30dCMP_cyt_deam_1158-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006558	`PF30953.1`	TAD3_N	29	131	1.4e-39	135.0
LXL04_006558	`PF00383.30`	dCMP_cyt_deam_1	158	328	8.9e-07	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KH86`	Arabidopsis thaliana	tRNA-specific adenosine deaminase TAD3	51.546%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card