LXL04_006536 | RubberDandelionOmics

Gene overview

LXL04_006536

Reference: OH-1004 Chr: Chr02 Coordinates: 13078598-13079695 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · LXL04_006536|LXL04_006536|OH1004|cDNA

ATGGGAATTCCACATGCAATTCTCGTACCTTATCCAGCTCAAGGTCACGTAATCCCCATGATGGAGCTCATGCAATTATTAGTCAAACAAGGATTGTTGAACGATTTACCAAGTCTTGTCTCGATACCAGATGGTCTGGGAGCTGGAGAGAATAGATTTGATTTGGGGAAGCTATCGGATGCAATCTATCGAGTCATGCCTGAAAAGCTTGAAGAGCTTATTGAACGACTTAATGGAAATGATGATGGTGAGAAAGTTAC...

CDS

Download CDS FASTA

663 bp · LXL04_006536|LXL04_006536|OH1004|CDS

ATGGGAATTCCACATGCAATTCTCGTACCTTATCCAGCTCAAGGTCACGTAATCCCCATGATGGAGCTCATGCAATTATTAGTCAAACAAGGATTGTTGAACGATTTACCAAGTCTTGTCTCGATACCAGATGGTCTGGGAGCTGGAGAGAATAGATTTGATTTGGGGAAGCTATCGGATGCAATCTATCGAGTCATGCCTGAAAAGCTTGAAGAGCTTATTGAACGACTTAATGGAAATGATGATGGTGAGAAAGTTAC...

Protein

Download Protein FASTA

220 aa · LXL04_006536|LXL04_006536|OH1004|PROTEIN

MGIPHAILVPYPAQGHVIPMMELMQLLVKQGLLNDLPSLVSIPDGLGAGENRFDLGKLSDAIYRVMPEKLEELIERLNGNDDGEKVTCIVADTCMGWAFGVAKKMKIKTFWPAAGVVLASLICIPKFIEDGIIDNKGTLMKKQVVQLSPTMPAITSSDFTWLSIGDIKTQQSLFDLILKANEFMELADRIFCNSTYELEPTTFTSFPNILPIGPLLASNC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006536`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006536

Location Chr02:13078598-13079695 (+)

Description Similar to UGT83A1: UDP-glycosyltransferase 83A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02100`	UDP-glycosyltransferase 83A1.	No verified direct reference in this release
`At1g22400`	Involved in the O-glucosylation of trans-zeatin and dihydrozeatin.	N-glucosylation of cytokinins by glycosyltransferases of Arabidopsis thaliana.2004 · DOI: 10.1074/jbc.m409569200
`At1g78270`	UDP-glycosyltransferase 85A4.	No verified direct reference in this release
`At2g36970`	UDP-glycosyltransferase 86A1.	No verified direct reference in this release
`At1g22360`	UDP-glycosyltransferase 85A2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006536 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0015020 glucuronosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0050403 trans-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0050502 cis-zeatin O-beta-D-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G22360

ath:AT1G22400

ath:AT1G78270

ath:AT2G36970

ath:AT3G02100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.780

Rank 1 · LXL04_006536 · OH-1004

Nucleus0.185

Rank 2 · LXL04_006536 · OH-1004

Endoplasmic reticulum0.090

Rank 3 · LXL04_006536 · OH-1004

Cell membrane0.046

Rank 4 · LXL04_006536 · OH-1004

Peroxisome0.042

Rank 5 · LXL04_006536 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGA8`	Arabidopsis thaliana	UDP-glycosyltransferase 83A1	39.592%	Swiss-Prot	moderate database homology
`Q9SK82`	Arabidopsis thaliana	UDP-glycosyltransferase 85A1	27.600%	Swiss-Prot	weak database homology
`Q9M9E7`	Arabidopsis thaliana	UDP-glycosyltransferase 85A4	29.435%	Swiss-Prot	weak database homology
`Q9SJL0`	Arabidopsis thaliana	UDP-glycosyltransferase 86A1	24.514%	Swiss-Prot	weak database homology
`Q9ZWJ3`	Arabidopsis thaliana	UDP-glycosyltransferase 85A2	26.210%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card