LXL04_006491 | RubberDandelionOmics

Gene overview

LXL04_006491

Reference: OH-1004 Chr: Chr02 Coordinates: 12129788-12131980 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1293 bp · LXL04_006491|LXL04_006491|OH1004|cDNA

ATGAAAATCGTCATCTCTGCTTGTGTTTTTCTTGTATTTTGTTCTTTCGCAGATGCTTTTGATCCGCTAGATCCAACTGGAAACATAACGATCAAATGGGACATAATGTCTTGGACCCCAGATGGTTATGTGGCAACTGTAACGATGAACAATTTCCAAATGTACCGCCATATCCAGACACCAGGGTGGACCTTAGGGTGGACATGGGCTAAAAAAGAAGTGATATGGGCCATGGTCGGGGCTCAAACCACCGAACAAGG...

CDS

Download CDS FASTA

1293 bp · LXL04_006491|LXL04_006491|OH1004|CDS

ATGAAAATCGTCATCTCTGCTTGTGTTTTTCTTGTATTTTGTTCTTTCGCAGATGCTTTTGATCCGCTAGATCCAACTGGAAACATAACGATCAAATGGGACATAATGTCTTGGACCCCAGATGGTTATGTGGCAACTGTAACGATGAACAATTTCCAAATGTACCGCCATATCCAGACACCAGGGTGGACCTTAGGGTGGACATGGGCTAAAAAAGAAGTGATATGGGCCATGGTCGGGGCTCAAACCACCGAACAAGG...

Protein

Download Protein FASTA

430 aa · LXL04_006491|LXL04_006491|OH1004|PROTEIN

MKIVISACVFLVFCSFADAFDPLDPTGNITIKWDIMSWTPDGYVATVTMNNFQMYRHIQTPGWTLGWTWAKKEVIWAMVGAQTTEQGDCSKFKANMPHCCKKTPTVVDLLPGVPYNQQIANCCKGGVVAAWGQDPSAAVSAFQVSVGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKVVPPTNFLTPDRRRKTQALMTWNVTCTYSQFLARKHPSCCVSFSSFYNETITACPNCACGCENKNKCVKSDSKLLSVVGVNTP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006491`
TK1151 ID	TkA03G042230
OH-1004 ID	LXL04_006491
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006491

Location Chr02:12129788-12131980 (+)

Description Similar to COBL4: COBRA-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15630`	COBRA-like protein 4.	No verified direct reference in this release
`At5g60920`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0416200`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release
`UniProt: A2XHZ9`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release
`Os07g0604400`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006491 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0052324 plant-type cell wall cellulose biosynthetic process Biological Process

GO:2001006 regulation of cellulose biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009897 external side of plasma membrane Cellular Component

GO:0009930 longitudinal side of cell surface Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT5G15630

ath:AT5G60920

dosa:Os03g0416200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.763

Rank 1 · LXL04_006491 · OH-1004

Extracellular0.133

Rank 2 · LXL04_006491 · OH-1004

Cytoplasm0.107

Rank 3 · LXL04_006491 · OH-1004

Endoplasmic reticulum0.072

Rank 4 · LXL04_006491 · OH-1004

Golgi apparatus0.052

Rank 5 · LXL04_006491 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04833.21COBRA_N43-206 aa

PF25079.2COB_C215-404 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006491	`PF04833.21`	COBRA_N	43	206	3.1e-69	232.9
LXL04_006491	`PF25079.2`	COB_C	215	404	6.3e-55	187.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFW3`	Arabidopsis thaliana	COBRA-like protein 4	85.158%	Swiss-Prot	strong database homology
`Q94KT8`	Arabidopsis thaliana	Protein COBRA	69.639%	Swiss-Prot	strong database homology
`Q10JL1`	Oryza sativa subsp. japonica	COBRA-like protein 5	71.560%	Swiss-Prot	strong database homology
`A2XHZ9`	Oryza sativa subsp. indica	COBRA-like protein 5	71.560%	Swiss-Prot	strong database homology
`Q6Z4G7`	Oryza sativa subsp. japonica	COBRA-like protein 6	70.139%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card