LXL04_006487 | RubberDandelionOmics

Gene overview

LXL04_006487

Reference: OH-1004 Chr: Chr02 Coordinates: 12097721-12100067 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1059 bp · LXL04_006487|LXL04_006487|OH1004|cDNA

ATGGCTGCTTCTTCCTCGTACCCGCTGAAAGATGAGCTCGATATTGTCATACCAACAATTCGTAACCTTGACTTCCTCGAAATGTGGCGGCCGTTTTTTCAGCCATATCATTTGATAATTGTTCAAGATGGTGATCCTTCTAGAATGATTAAGGTCCCTGATGGCTTTGATTATGAGCTTTATAATCGTAACGATATTAATAAGATATTGGGTCCTAAAGCTTCGTGTATATCGTTCAAGGATTCGGCGTGTCGATGCTT...

CDS

Download CDS FASTA

1059 bp · LXL04_006487|LXL04_006487|OH1004|CDS

ATGGCTGCTTCTTCCTCGTACCCGCTGAAAGATGAGCTCGATATTGTCATACCAACAATTCGTAACCTTGACTTCCTCGAAATGTGGCGGCCGTTTTTTCAGCCATATCATTTGATAATTGTTCAAGATGGTGATCCTTCTAGAATGATTAAGGTCCCTGATGGCTTTGATTATGAGCTTTATAATCGTAACGATATTAATAAGATATTGGGTCCTAAAGCTTCGTGTATATCGTTCAAGGATTCGGCGTGTCGATGCTT...

Protein

Download Protein FASTA

352 aa · LXL04_006487|LXL04_006487|OH1004|PROTEIN

MAASSSYPLKDELDIVIPTIRNLDFLEMWRPFFQPYHLIIVQDGDPSRMIKVPDGFDYELYNRNDINKILGPKASCISFKDSACRCFGYMVSKKKYIFTIDDDCFVAKDPTGKDIDALRQHINNLLRPSTPYFFNTLYDPFTEGADFVRGYPFSLREGVPTAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTLPKGILFPMCGMNLAFDRSLIGPAMYFGLMGDGQPIGRYDDMWAGWCVKVICDHLGLGIKTGLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006487`
TK1151 ID	TkA03G041120
OH-1004 ID	LXL04_006487
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006487

Location Chr02:12097721-12100067 (-)

Description Similar to UPTG2: Probable UDP-arabinopyranose mutase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0599800`	UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006487 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0033356 UDP-L-arabinose metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016866 intramolecular transferase activity Molecular Function

GO:0052691 UDP-arabinopyranose mutase activity Molecular Function

KEGG gene cross-reference

dosa:Os03g0599800

zma:542592

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.415

Rank 1 · LXL04_006487 · OH-1004

Golgi apparatus0.325

Rank 2 · LXL04_006487 · OH-1004

Endoplasmic reticulum0.197

Rank 3 · LXL04_006487 · OH-1004

Nucleus0.165

Rank 4 · LXL04_006487 · OH-1004

Cell membrane0.127

Rank 5 · LXL04_006487 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03214.20RGP10-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006487	`PF03214.20`	RGP	10	343	7.3e-177	588.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H8T0`	Oryza sativa subsp. japonica	UDP-arabinopyranose mutase 1	88.393%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card