LXL04_006467 | RubberDandelionOmics

Gene overview

LXL04_006467

Reference: OH-1004 Chr: Chr02 Coordinates: 11441649-11445000 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1272 bp · LXL04_006467|LXL04_006467|OH1004|cDNA

ATGGTTGCCAAATCTGATTTAGTGATCATTGGAATCTGTGTTGGTGTGGCTGTTGGTGTACTTGTGGCATCACTTGTATTCTTTGGTATACGGTGGTACAGAAGGCGGGCCCACCTTAGAAGATGTGGAAATGACAGAAGTGCATCAAGTCTTCCTATACGTAGAAATGGTGTGGATACAAGTATTATTTTGAGTGAATCGTATTCCAATTCAGTCACTGTTAAAGTGTCCACTTATCCTGTAAAGACTTCTTCGCCTCT...

CDS

Download CDS FASTA

1272 bp · LXL04_006467|LXL04_006467|OH1004|CDS

ATGGTTGCCAAATCTGATTTAGTGATCATTGGAATCTGTGTTGGTGTGGCTGTTGGTGTACTTGTGGCATCACTTGTATTCTTTGGTATACGGTGGTACAGAAGGCGGGCCCACCTTAGAAGATGTGGAAATGACAGAAGTGCATCAAGTCTTCCTATACGTAGAAATGGTGTGGATACAAGTATTATTTTGAGTGAATCGTATTCCAATTCAGTCACTGTTAAAGTGTCCACTTATCCTGTAAAGACTTCTTCGCCTCT...

Protein

Download Protein FASTA

423 aa · LXL04_006467|LXL04_006467|OH1004|PROTEIN

MVAKSDLVIIGICVGVAVGVLVASLVFFGIRWYRRRAHLRRCGNDRSASSLPIRRNGVDTSIILSESYSNSVTVKVSTYPVKTSSPLAKWNNKNGKEQLAAVSGLPRYSYKDIQKATKNFTTILGQGSFGPVYKATMPAGEVVAVKVLASDSKQGEKEFQTEVSLLGRLHHRNLVNLVGYCVDKGQRMLIYEYMSNGSLASFLYDDKKQALNWEERVQIALDISHGIEYLHDGAVPPVIHRDLKSANILLDHFVRAKVAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006467`
TK1151 ID	TkA03G039740
OH-1004 ID	LXL04_006467
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006467

Location Chr02:11441649-11445000 (-)

Description Similar to CRLK2: Calcium/calmodulin-regulated receptor-like kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15730`	Calcium/calmodulin-regulated receptor-like kinase 2.	No verified direct reference in this release
`At5g54590`	Required for cold tolerance, via the activation of MAP kinases activity.	Phosphorylation of Arabidopsis thaliana MEKK1 via Ca(2+) signaling as a part of the cold stress response.2013 · DOI: 10.1007/s10265-013-0576-0
`At5g48740`	Probable LRR receptor-like serine/threonine-protein kinase At5g48740.	No verified direct reference in this release
`At1g20650`	May be involved in plant defense signaling.	No verified direct reference in this release
`At3g07070`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006467 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009631 cold acclimation Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G20650

ath:AT3G07070

ath:AT5G15730

ath:AT5G48740

ath:AT5G54590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.774

Rank 1 · LXL04_006467 · OH-1004

Cytoplasm0.163

Rank 2 · LXL04_006467 · OH-1004

Nucleus0.137

Rank 3 · LXL04_006467 · OH-1004

Endoplasmic reticulum0.053

Rank 4 · LXL04_006467 · OH-1004

Golgi apparatus0.029

Rank 5 · LXL04_006467 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr120-376 aa

PF00069.32Pkinase122-376 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006467	`PF07714.24`	PK_Tyr_Ser-Thr	120	376	3.3e-51	174.8
LXL04_006467	`PF00069.32`	Pkinase	122	376	9.8e-49	166.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFV3`	Arabidopsis thaliana	Calcium/calmodulin-regulated receptor-like kinase 2	61.949%	Swiss-Prot	strong database homology
`Q9FIU5`	Arabidopsis thaliana	Calcium/calmodulin-regulated receptor-like kinase 1	53.553%	Swiss-Prot	strong database homology
`C0LGV0`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At5g48740	43.299%	Swiss-Prot	moderate database homology
`Q9LDZ5`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL21	40.432%	Swiss-Prot	moderate database homology
`Q9SFT7`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL26	42.951%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card