LXL04_006389 | RubberDandelionOmics

Gene overview

LXL04_006389

Reference: OH-1004 Chr: Chr02 Coordinates: 9545312-9545890 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

579 bp · LXL04_006389|LXL04_006389|OH1004|cDNA

ATGGAACCTTCAAAAGTCCCCAAATCATTCGGTTGTTTCCCTCAAAAGGGTAATTTGCTCGTGAAACTAAGCAGCTTTCGTTCCAAGAGTAGTACCGCCACTTCAAACTCAACCACCCCTACGTTAATGTCTCCCAAATCCCCAAAACCAAACACGATCAACAGACAATTACAAGATTTCAGATGGGTTTTCGCTCGTTTTGACACCGACAACGACGGAAAGATTTCAGCTTTGGAGCTCCGATCATACTTCGGGTCCAT...

CDS

Download CDS FASTA

579 bp · LXL04_006389|LXL04_006389|OH1004|CDS

ATGGAACCTTCAAAAGTCCCCAAATCATTCGGTTGTTTCCCTCAAAAGGGTAATTTGCTCGTGAAACTAAGCAGCTTTCGTTCCAAGAGTAGTACCGCCACTTCAAACTCAACCACCCCTACGTTAATGTCTCCCAAATCCCCAAAACCAAACACGATCAACAGACAATTACAAGATTTCAGATGGGTTTTCGCTCGTTTTGACACCGACAACGACGGAAAGATTTCAGCTTTGGAGCTCCGATCATACTTCGGGTCCAT...

Protein

Download Protein FASTA

192 aa · LXL04_006389|LXL04_006389|OH1004|PROTEIN

MEPSKVPKSFGCFPQKGNLLVKLSSFRSKSSTATSNSTTPTLMSPKSPKPNTINRQLQDFRWVFARFDTDNDGKISALELRSYFGSIGEYMSHQEAQCVIDDLDVDGDGFIDFEDFMRLMKVKDEGDDVKAAFEMFEHEKGCGQISPKSLQKTLSRLGESKSYDECLKMIKVFDVHGKGGVDFNEFQQMMMT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006389`
TK1151 ID	TkA03G028980
OH-1004 ID	LXL04_006389
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 78.125 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006389

Location Chr02:9545312-9545890 (-)

Description Similar to CML41: Probable calcium-binding protein CML41

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50770`	Potential calcium sensor.	No verified direct reference in this release
`At1g66400`	Potential calcium sensor.	No verified direct reference in this release
`At1g76650`	Potential calcium sensor that binds calcium in vitro.	Developmental and stimulus-induced expression patterns of Arabidopsis calmodulin-like genes CML37, CML38 and CML39.2007 · DOI: 10.1007/s11103-007-9189-0
`At1g18210`	Potential calcium sensor.	No verified direct reference in this release
`At1g73630`	Potential calcium sensor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006389 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0009611 response to wounding Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0071731 response to nitric oxide Biological Process

GO:0080164 regulation of nitric oxide metabolic process Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G18210

ath:AT1G66400

ath:AT1G76650

ath:AT3G50770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.393

Rank 1 · LXL04_006389 · OH-1004

Nucleus0.288

Rank 2 · LXL04_006389 · OH-1004

Cell membrane0.145

Rank 3 · LXL04_006389 · OH-1004

Plastid0.124

Rank 4 · LXL04_006389 · OH-1004

Endoplasmic reticulum0.119

Rank 5 · LXL04_006389 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21008.4AIF-142-124 aa

PF13499.13EF-hand_759-121 aa

PF00036.39EF-hand_159-84 aa

PF13405.13EF-hand_663-88 aa

PF13202.13EF-hand_563-82 aa

PF13833.13EF-hand_888-121 aa

PF00036.39EF-hand_197-121 aa

PF13405.13EF-hand_699-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006389	`PF21008.4`	AIF-1	42	124	5.2e-10	40.4
LXL04_006389	`PF13499.13`	EF-hand_7	59	121	1.4e-21	77.3
LXL04_006389	`PF00036.39`	EF-hand_1	59	84	7.5e-19	66.5
LXL04_006389	`PF13405.13`	EF-hand_6	63	88	2.2e-18	64.9
LXL04_006389	`PF13202.13`	EF-hand_5	63	82	2.9e-14	52.5
LXL04_006389	`PF13833.13`	EF-hand_8	88	121	1.3e-13	51.2
LXL04_006389	`PF00036.39`	EF-hand_1	97	121	7.5e-19	66.5
LXL04_006389	`PF13405.13`	EF-hand_6	99	121	2.2e-18	64.9
LXL04_006389	`PF13202.13`	EF-hand_5	101	120	2.9e-14	52.5
LXL04_006389	`PF13499.13`	EF-hand_7	140	191	1.4e-21	77.3
LXL04_006389	`PF13833.13`	EF-hand_8	143	190	1.3e-13	51.2
LXL04_006389	`PF00036.39`	EF-hand_1	165	191	7.5e-19	66.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L3R2`	Arabidopsis thaliana	Probable calcium-binding protein CML41	48.469%	Swiss-Prot	moderate database homology
`Q9C8Y1`	Arabidopsis thaliana	Probable calcium-binding protein CML23	37.324%	Swiss-Prot	moderate database homology
`Q9SRE6`	Arabidopsis thaliana	Calcium-binding protein CML38	41.429%	Swiss-Prot	moderate database homology
`Q9LE22`	Arabidopsis thaliana	Probable calcium-binding protein CML27	36.111%	Swiss-Prot	moderate database homology
`Q9C9U8`	Arabidopsis thaliana	Probable calcium-binding protein CML26	36.735%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card