LXL04_006278 | RubberDandelionOmics

Gene overview

LXL04_006278

Reference: OH-1004 Chr: Chr02 Coordinates: 5966967-5971910 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1488 bp · LXL04_006278|LXL04_006278|OH1004|cDNA

ATGGGAGTGGTAATGGCGTGGAATGGTTACATGCTTCCTCCGCAAACGGAAGGTAAAGTTACATCTCCTGCACGGCGGTTTGTCGGTCGCCGGAAACTCTGTTTCGATGGAATTTCCTCCGTGTGTTCGTCCTCAGACACGCATCATGACGATGACTCGGTTGCACCTCGTCATCGCGTCTTCACCAAAACAGTTGGTGAAAAAACACTTAAAGATCTGAAAGAGGTTACGAGTGGTTTTCTTACAACACGCAGAATGCT...

CDS

Download CDS FASTA

1488 bp · LXL04_006278|LXL04_006278|OH1004|CDS

ATGGGAGTGGTAATGGCGTGGAATGGTTACATGCTTCCTCCGCAAACGGAAGGTAAAGTTACATCTCCTGCACGGCGGTTTGTCGGTCGCCGGAAACTCTGTTTCGATGGAATTTCCTCCGTGTGTTCGTCCTCAGACACGCATCATGACGATGACTCGGTTGCACCTCGTCATCGCGTCTTCACCAAAACAGTTGGTGAAAAAACACTTAAAGATCTGAAAGAGGTTACGAGTGGTTTTCTTACAACACGCAGAATGCT...

Protein

Download Protein FASTA

495 aa · LXL04_006278|LXL04_006278|OH1004|PROTEIN

MGVVMAWNGYMLPPQTEGKVTSPARRFVGRRKLCFDGISSVCSSSDTHHDDDSVAPRHRVFTKTVGEKTLKDLKEVTSGFLTTRRMLLTSLLMPLYYPPSRYSSGSNNPFPSFHSVSFNPSSVFFLTFCMNISRAANALGDPSVTLEQVTPVVIPSGPLFPPEERIVKLFENNTYSVVNIFDVTLRPQLNVTGVVEIPEGNGSGVVWDEEGHIVTNYHGIIGNSLSRNPQPGQVVARVNILASEGVQKNFEAKLIGADRS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006278`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006278

Location Chr02:5966967-5971910 (+)

Description Similar to DEGP8: Protease Do-like 8, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39830`	Probable serine protease.	No verified direct reference in this release
`At3g27925`	Serine protease that is required at high temperature.	High light stimulates Deg1-dependent cleavage of the minor LHCII antenna proteins CP26 and CP29 and the PsbS protein in Arabidopsis thaliana.2012 · DOI: 10.1007/s00425-011-1505-x Identification and characterization of DegP, a serine protease associated with the luminal side of the thylakoid membrane.1998 · DOI: 10.1074/jbc.273.12.7094
`At4g18370`	Probable serine protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006278 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0010206 photosystem II repair Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

KEGG gene cross-reference

ath:AT3G27925

ath:AT4G18370

ath:AT5G39830

bme:BMEI1330

bmel:DK63_73

bms:BR0611

bsi:BS1330_I0607

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981

Rank 1 · LXL04_006278 · OH-1004

Mitochondrion0.028

Rank 2 · LXL04_006278 · OH-1004

Cytoplasm0.017

Rank 3 · LXL04_006278 · OH-1004

Nucleus0.012

Rank 4 · LXL04_006278 · OH-1004

Peroxisome0.012

Rank 5 · LXL04_006278 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13365.13Trypsin_2202-354 aa

PF00089.33Trypsin204-380 aa

PF13180.13PDZ_2413-490 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006278	`PF13365.13`	Trypsin_2	202	354	1.7e-27	97.7
LXL04_006278	`PF00089.33`	Trypsin	204	380	4e-15	57.0
LXL04_006278	`PF13180.13`	PDZ_2	413	490	8.7e-08	33.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU10`	Arabidopsis thaliana	Protease Do-like 8, chloroplastic	70.913%	Swiss-Prot	strong database homology
`O22609`	Arabidopsis thaliana	Protease Do-like 1, chloroplastic	45.170%	Swiss-Prot	moderate database homology
`Q9SEL7`	Arabidopsis thaliana	Protease Do-like 5, chloroplastic	47.234%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card