LXL04_006177 | RubberDandelionOmics

Gene overview

LXL04_006177

Reference: OH-1004 Chr: Chr02 Coordinates: 3071290-3072604 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

537 bp · LXL04_006177|LXL04_006177|OH1004|cDNA

ATGGCCATGAAACTTCATCTCCTCCTTCTTGTTTCTTTTCTTCTGGTTTCTACTTCCATTTCATCCTATGATCAAGAGGCTGCATTTGCCACCACCCCTGCCGGCAAAACCACACCACCACCAAAACCATCACCGTCCCCTCCTCTACCGGTGACTAAACCCCCCACCGCTACACCACCAGTTGCTAAACCACCCACCGCCACATCACCAGTAGCTAAACCGCCCACCGCCGCCCCACCAGTCGCCAAGCCACCCACCAC...

CDS

Download CDS FASTA

537 bp · LXL04_006177|LXL04_006177|OH1004|CDS

ATGGCCATGAAACTTCATCTCCTCCTTCTTGTTTCTTTTCTTCTGGTTTCTACTTCCATTTCATCCTATGATCAAGAGGCTGCATTTGCCACCACCCCTGCCGGCAAAACCACACCACCACCAAAACCATCACCGTCCCCTCCTCTACCGGTGACTAAACCCCCCACCGCTACACCACCAGTTGCTAAACCACCCACCGCCACATCACCAGTAGCTAAACCGCCCACCGCCGCCCCACCAGTCGCCAAGCCACCCACCAC...

Protein

Download Protein FASTA

178 aa · LXL04_006177|LXL04_006177|OH1004|PROTEIN

MAMKLHLLLLVSFLLVSTSISSYDQEAAFATTPAGKTTPPPKPSPSPPLPVTKPPTATPPVAKPPTATSPVAKPPTAAPPVAKPPTTAPPVAKPPTTAPPVAKPPTAAPPTPPRNTKECYPPCVVRCKNHSRQNVCLRACVTCCDRCKCVPPGQSGNKEVCGSCYTNMKTHGGRPKCP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006177`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006177

Location Chr02:3071290-3072604 (+)

Description Similar to GASA14: Gibberellin-regulated protein 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14920`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release
`At1g75750`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release
`At4g09600`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006177 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005882 intermediate filament Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0005200 structural constituent of cytoskeleton Molecular Function

KEGG gene cross-reference

ath:AT5G14920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.877

Rank 1 · LXL04_006177 · OH-1004

Endoplasmic reticulum0.060

Rank 2 · LXL04_006177 · OH-1004

Cell membrane0.042

Rank 3 · LXL04_006177 · OH-1004

Cytoplasm0.040

Rank 4 · LXL04_006177 · OH-1004

Plastid0.021

Rank 5 · LXL04_006177 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02095.22Extensin_139-122 aa

PF02704.20GASA118-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006177	`PF02095.22`	Extensin_1	39	122	2.5e-09	37.9
LXL04_006177	`PF02704.20`	GASA	118	178	1.8e-19	70.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFR3`	Arabidopsis thaliana	Gibberellin-regulated protein 14	69.231%	Swiss-Prot	weak database homology
`P46689`	Arabidopsis thaliana	Gibberellin-regulated protein 1	54.098%	Swiss-Prot	weak database homology
`P46687`	Arabidopsis thaliana	Gibberellin-regulated protein 3	54.098%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card