LXL04_006119 | RubberDandelionOmics

Gene overview

LXL04_006119

Reference: OH-1004 Chr: Chr02 Coordinates: 1985914-1989924 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1434 bp · LXL04_006119|LXL04_006119|OH1004|cDNA

ATGGCGCTTCCGATACCGATTCCTTGCACTTCTTCAGTTTTCCACCGCCATAGCATTTGCAGGAAAGCATCATCGCCTCAAATCCCTCGCCAATCTCATTTATTATGGAAGAATTTCGAATTTTCAGCTTCAAATACTCGGTTTTCTTGCTCGAAGGTTCCGTGCAGTTCTTCAGTTTTCCACCGCCATAGCATATGCCGGAAAGCATCTCCGACTCAGATCCGTCGCAAACTTCATCCATTATGGAAGAATTTCGATTT...

CDS

Download CDS FASTA

1434 bp · LXL04_006119|LXL04_006119|OH1004|CDS

ATGGCGCTTCCGATACCGATTCCTTGCACTTCTTCAGTTTTCCACCGCCATAGCATTTGCAGGAAAGCATCATCGCCTCAAATCCCTCGCCAATCTCATTTATTATGGAAGAATTTCGAATTTTCAGCTTCAAATACTCGGTTTTCTTGCTCGAAGGTTCCGTGCAGTTCTTCAGTTTTCCACCGCCATAGCATATGCCGGAAAGCATCTCCGACTCAGATCCGTCGCAAACTTCATCCATTATGGAAGAATTTCGATTT...

Protein

Download Protein FASTA

477 aa · LXL04_006119|LXL04_006119|OH1004|PROTEIN

MALPIPIPCTSSVFHRHSICRKASSPQIPRQSHLLWKNFEFSASNTRFSCSKVPCSSSVFHRHSICRKASPTQIRRKLHPLWKNFDFFASNTRFSCSKSDLQLHVSSSNEVLLKYHRHFCKLFVNEAVAVCDLVLRCVFWLQFIENLMDCVDLSEKEAQASLEFLLRDGSEALISAFLVLLRAKGETFEEIVGLAKAMINNGRKVEGIKDAVDIVGTGGDGHNTVNISTGAALLVAACGAKVAKQGNRSSSSACGSADVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006119`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006119

Location Chr02:1985914-1989924 (-)

Description Similar to PAT1: Anthranilate phosphoribosyltransferase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17990`	Anthranilate phosphoribosyltransferase, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006119 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004048 anthranilate phosphoribosyltransferase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G17990

cca:CCA_00563

cfe:CF0439

deh:cbdbA1444

msi:Msm_1144

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.899

Rank 1 · LXL04_006119 · OH-1004

Mitochondrion0.130

Rank 2 · LXL04_006119 · OH-1004

Cytoplasm0.069

Rank 3 · LXL04_006119 · OH-1004

Peroxisome0.036

Rank 4 · LXL04_006119 · OH-1004

Nucleus0.034

Rank 5 · LXL04_006119 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02885.23Glycos_trans_3N142-202 aa

PF00591.28Glycos_transf_3209-459 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006119	`PF02885.23`	Glycos_trans_3N	142	202	3e-13	50.0
LXL04_006119	`PF00591.28`	Glycos_transf_3	209	459	2.4e-98	329.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q02166`	Arabidopsis thaliana	Anthranilate phosphoribosyltransferase, chloroplastic	76.596%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card