LXL04_006091 | RubberDandelionOmics

Gene overview

LXL04_006091

Reference: OH-1004 Chr: Chr02 Coordinates: 1627197-1630681 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1860 bp · LXL04_006091|LXL04_006091|OH1004|cDNA

ATGAAAATGAAGTCAACTGCTAGCGAACTCATTCGGCGGAAAAAGTTATTGAAACATGTTTTGCTAGGTTTAATTGCACTTCTCGGTTTGATTTGCCTGTACAATGCTTCGACATTTGCTCCTGGAGCGGAAGAAGTTATCGGTTCCGACGACGGTGCGGATCCAGTCACCGGAATTTTTCGACCGAAACGTGATTATTTCGATGAATTGTTTGAAGATCAAGAGCAAAATCCCGAGGTTCCCAAAAGCTTACCTATTTG...

CDS

Download CDS FASTA

1860 bp · LXL04_006091|LXL04_006091|OH1004|CDS

ATGAAAATGAAGTCAACTGCTAGCGAACTCATTCGGCGGAAAAAGTTATTGAAACATGTTTTGCTAGGTTTAATTGCACTTCTCGGTTTGATTTGCCTGTACAATGCTTCGACATTTGCTCCTGGAGCGGAAGAAGTTATCGGTTCCGACGACGGTGCGGATCCAGTCACCGGAATTTTTCGACCGAAACGTGATTATTTCGATGAATTGTTTGAAGATCAAGAGCAAAATCCCGAGGTTCCCAAAAGCTTACCTATTTG...

Protein

Download Protein FASTA

619 aa · LXL04_006091|LXL04_006091|OH1004|PROTEIN

MKMKSTASELIRRKKLLKHVLLGLIALLGLICLYNASTFAPGAEEVIGSDDGADPVTGIFRPKRDYFDELFEDQEQNPEVPKSLPICDTRYSELIPCLDRHLIYQLKLKLNLTLMEHYERHCPPPERRYNCLIPPPSGYKIPIRWPESRDEVWKANIPHTHLAQEKSDQNWMIVMGEKIRFPGGGTHFHSGADKYIASIASMLKFPNDKLNNGGNIRTVLDVGCGVASFGAYLLPLGIISMSLAPNDVHQNQIQFALERG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006091`
TK1151 ID	TkA03G009090
OH-1004 ID	LXL04_006091
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006091

Location Chr02:1627197-1630681 (+)

Description Similar to At5g14430: Probable methyltransferase PMT9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14430`	Probable methyltransferase PMT9.	No verified direct reference in this release
`At3g23300`	Probable methyltransferase PMT1.	No verified direct reference in this release
`At1g04430`	Probable methyltransferase PMT8.	No verified direct reference in this release
`At4g14360`	Probable methyltransferase PMT3.	No verified direct reference in this release
`At5g04060`	Probable methyltransferase PMT7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006091 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009505 plant-type cell wall Cellular Component

KEGG gene cross-reference

ath:AT1G04430

ath:AT3G23300

ath:AT4G14360

ath:AT5G04060

ath:AT5G14430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.800

Rank 1 · LXL04_006091 · OH-1004

Endoplasmic reticulum0.077

Rank 2 · LXL04_006091 · OH-1004

Cell membrane0.060

Rank 3 · LXL04_006091 · OH-1004

Extracellular0.057

Rank 4 · LXL04_006091 · OH-1004

Cytoplasm0.040

Rank 5 · LXL04_006091 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141.23Methyltransf_2993-590 aa

PF13649.13Methyltransf_25219-311 aa

PF08241.19Methyltransf_11220-314 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006091	`PF03141.23`	Methyltransf_29	93	590	7.9e-224	744.6
LXL04_006091	`PF13649.13`	Methyltransf_25	219	311	4e-07	31.3
LXL04_006091	`PF08241.19`	Methyltransf_11	220	314	2.2e-09	38.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZV7`	Arabidopsis thaliana	Probable methyltransferase PMT9	71.967%	Swiss-Prot	strong database homology
`Q8H118`	Arabidopsis thaliana	Probable methyltransferase PMT1	67.225%	Swiss-Prot	strong database homology
`Q940J9`	Arabidopsis thaliana	Probable methyltransferase PMT8	61.338%	Swiss-Prot	strong database homology
`Q93YV7`	Arabidopsis thaliana	Probable methyltransferase PMT3	66.541%	Swiss-Prot	strong database homology
`Q9LZA4`	Arabidopsis thaliana	Probable methyltransferase PMT7	46.154%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card