LXL04_006084 | RubberDandelionOmics

Gene overview

LXL04_006084

Reference: OH-1004 Chr: Chr02 Coordinates: 1533444-1536464 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · LXL04_006084|LXL04_006084|OH1004|cDNA

ATGGCTCCTATTAACAACAATGTACAAATCAATAACAACGAACACCCCCCAAAATACAAGGTTACAATCGTCGGAAGTGGCAATTGGGGTAGTGTTGCTTCCAAGCTCATTGCTTCAAATACCCTCAAGCTTTCTTCGTTCCATGATGAAGTGAAGATGTGGGTGTTTGAGGAAACATTACCGAGTGGTGAAAAGCTCACAGACGTTATCAATCAAACCAATGAAAATGTGAAATATTTACCTGGGATTAAGCTTGGACG...

CDS

Download CDS FASTA

1131 bp · LXL04_006084|LXL04_006084|OH1004|CDS

ATGGCTCCTATTAACAACAATGTACAAATCAATAACAACGAACACCCCCCAAAATACAAGGTTACAATCGTCGGAAGTGGCAATTGGGGTAGTGTTGCTTCCAAGCTCATTGCTTCAAATACCCTCAAGCTTTCTTCGTTCCATGATGAAGTGAAGATGTGGGTGTTTGAGGAAACATTACCGAGTGGTGAAAAGCTCACAGACGTTATCAATCAAACCAATGAAAATGTGAAATATTTACCTGGGATTAAGCTTGGACG...

Protein

Download Protein FASTA

376 aa · LXL04_006084|LXL04_006084|OH1004|PROTEIN

MAPINNNVQINNNEHPPKYKVTIVGSGNWGSVASKLIASNTLKLSSFHDEVKMWVFEETLPSGEKLTDVINQTNENVKYLPGIKLGRNVVADPDLVNAVRDANMLVFVTPHQFMEGICKKLIGNIRSDAQAISLIKGMEVKKEGPCMISTLISQQLGVNCCVLMGANIANEIAVEKFSEATVGYRGNREIAENWVQLFSTSYFMVSACQDVEGVELCGTLKNVVAIAAGFVDGLDMGNNTKAAIMRIGLREMKGLSKLLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006084`
TK1151 ID	TkA03G008830
OH-1004 ID	LXL04_006084
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006084

Location Chr02:1533444-1536464 (+)

Description Similar to GPDH: Glycerol-3-phosphate dehydrogenase [NAD(+)]

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40610`	Involved in glycerolipid metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006084 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002027 regulation of heart rate Biological Process

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006072 glycerol-3-phosphate metabolic process Biological Process

GO:0006094 gluconeogenesis Biological Process

GO:0006650 glycerophospholipid metabolic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0010765 positive regulation of sodium ion transport Biological Process

GO:0019674 NAD+ metabolic process Biological Process

GO:0046168 glycerol-3-phosphate catabolic process Biological Process

GO:0060373 regulation of ventricular cardiac muscle cell membrane depolarization Biological Process

GO:0086005 ventricular cardiac muscle cell action potential Biological Process

GO:2000010 positive regulation of protein localization to cell surface Biological Process

KEGG gene cross-reference

ath:AT5G40610

bta:525042

hsa:23171

pon:100173675

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.458

Rank 1 · LXL04_006084 · OH-1004

Mitochondrion0.296

Rank 2 · LXL04_006084 · OH-1004

Nucleus0.217

Rank 3 · LXL04_006084 · OH-1004

Peroxisome0.089

Rank 4 · LXL04_006084 · OH-1004

Cell membrane0.061

Rank 5 · LXL04_006084 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01210.30NAD_Gly3P_dh_N20-185 aa

PF07479.20NAD_Gly3P_dh_C210-358 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006084	`PF01210.30`	NAD_Gly3P_dh_N	20	185	5.7e-40	137.6
LXL04_006084	`PF07479.20`	NAD_Gly3P_dh_C	210	358	8.3e-47	159.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCX9`	Arabidopsis thaliana	Glycerol-3-phosphate dehydrogenase [NAD(+)] 1, chloroplastic	86.127%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card