LXL04_006083 | RubberDandelionOmics

Gene overview

LXL04_006083

Reference: OH-1004 Chr: Chr02 Coordinates: 1528069-1529053 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · LXL04_006083|LXL04_006083|OH1004|cDNA

ATGGCAGCGGGATCCGATGCCGCATCCGCCTCCGGCAACAGCTTCTCGTCCGCCGCTCAGGGCGGCATGACGGTCGATGAGTGCGATACGATGATCCAAAGAAGCCTCAGAACTCCATCGGTGAAGTTTTTACGGGAGCATTTGGAGAAAAGTGGATGCAAGATCGCGTCTAATTTCATCAAGGCTGTTAATTGCGACCAACAGATGAGCGGTGGTTATGTTCGTGGAGAAGGGATAGTTGTATGCAGCAACTACATGAA...

CDS

Download CDS FASTA

591 bp · LXL04_006083|LXL04_006083|OH1004|CDS

ATGGCAGCGGGATCCGATGCCGCATCCGCCTCCGGCAACAGCTTCTCGTCCGCCGCTCAGGGCGGCATGACGGTCGATGAGTGCGATACGATGATCCAAAGAAGCCTCAGAACTCCATCGGTGAAGTTTTTACGGGAGCATTTGGAGAAAAGTGGATGCAAGATCGCGTCTAATTTCATCAAGGCTGTTAATTGCGACCAACAGATGAGCGGTGGTTATGTTCGTGGAGAAGGGATAGTTGTATGCAGCAACTACATGAA...

Protein

Download Protein FASTA

196 aa · LXL04_006083|LXL04_006083|OH1004|PROTEIN

MAAGSDAASASGNSFSSAAQGGMTVDECDTMIQRSLRTPSVKFLREHLEKSGCKIASNFIKAVNCDQQMSGGYVRGEGIVVCSNYMNIQDEVNQVVIHELIHAFDDCRAANLDWTNCAHHACSEIRAGHLSGDCHYKRELLRGFVKIRGHEQECVRRRVMKSLANNPYCSESASKDAMEAVWETCYNDTKPFDRAP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006083`
TK1151 ID	TkA03G008820
OH-1004 ID	LXL04_006083
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006083

Location Chr02:1528069-1529053 (+)

Description Similar to ATP23: Mitochondrial inner membrane protease ATP23 (Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03420`	Has a dual role in the assembly of mitochondrial ATPase (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006083 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0033615 mitochondrial proton-transporting ATP synthase complex assembly Biological Process

GO:0034982 mitochondrial protein processing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004222 metalloendopeptidase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G03420

cnb:CNBE3400

cne:CNE03410

spo:2538697

yli:2908892

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.691

Rank 1 · LXL04_006083 · OH-1004

Cytoplasm0.144

Rank 2 · LXL04_006083 · OH-1004

Nucleus0.105

Rank 3 · LXL04_006083 · OH-1004

Cell membrane0.074

Rank 4 · LXL04_006083 · OH-1004

Golgi apparatus0.069

Rank 5 · LXL04_006083 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09768.16Peptidase_M7627-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006083	`PF09768.16`	Peptidase_M76	27	193	4.4e-61	206.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRP6`	Arabidopsis thaliana	Mitochondrial inner membrane protease ATP23	72.632%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card