LXL04_006080 | RubberDandelionOmics

Gene overview

LXL04_006080

Reference: OH-1004 Chr: Chr02 Coordinates: 1421913-1424040 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

810 bp · LXL04_006080|LXL04_006080|OH1004|cDNA

ATGGGATCATGGAATTCAACAGAGATGGAGGTTTTATCCAGTGTATTCGGATGGATTGCGTTCTGTGCTTGGTCTATCAGCTTTTATCCACAAGTCATACTGAATTTCAAAAGGAAAAGTGTAATAGGGCTGAATTTCGATTTCGTGGTGCTGAATCTGACTAAGCATTCGTCGTATCTGATATACAACGCCTCCGTCTTCTTTAGCTCCGCCGTTCAACGTCAGTATCACCAGAAATATGGCTTCAACGAGATGATACC...

CDS

Download CDS FASTA

810 bp · LXL04_006080|LXL04_006080|OH1004|CDS

ATGGGATCATGGAATTCAACAGAGATGGAGGTTTTATCCAGTGTATTCGGATGGATTGCGTTCTGTGCTTGGTCTATCAGCTTTTATCCACAAGTCATACTGAATTTCAAAAGGAAAAGTGTAATAGGGCTGAATTTCGATTTCGTGGTGCTGAATCTGACTAAGCATTCGTCGTATCTGATATACAACGCCTCCGTCTTCTTTAGCTCCGCCGTTCAACGTCAGTATCACCAGAAATATGGCTTCAACGAGATGATACC...

Protein

Download Protein FASTA

269 aa · LXL04_006080|LXL04_006080|OH1004|PROTEIN

MGSWNSTEMEVLSSVFGWIAFCAWSISFYPQVILNFKRKSVIGLNFDFVVLNLTKHSSYLIYNASVFFSSAVQRQYHQKYGFNEMIPVAANDVAFSIHAVVLTAFTLFQIAIYDRGGQKVSKTSISILSVAWLTVIICVFIAIPNHSWLWLVSCFSTLQVVMTVIKYIPQAVMNFKRKSTVGFSIGNILLDLLGGLANYGQMAVQSIDQHSWVNFYGNIGKTLLSLVSIFFDILFILQHYVVYPAHKSVKPQSSDLVSQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006080`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006080

Location Chr02:1421913-1424040 (+)

Description Similar to At5g40670: Cystinosin homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40670`	Thought to transport cystine out of lysosomes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006080 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006520 amino acid metabolic process Biological Process

GO:0006749 glutathione metabolic process Biological Process

GO:0010730 negative regulation of hydrogen peroxide biosynthetic process Biological Process

GO:0010918 positive regulation of mitochondrial membrane potential Biological Process

GO:0015031 protein transport Biological Process

GO:0015811 L-cystine transport Biological Process

GO:0035623 renal D-glucose absorption Biological Process

GO:0035672 oligopeptide transmembrane transport Biological Process

GO:0042438 melanin biosynthetic process Biological Process

GO:0046034 ATP metabolic process Biological Process

GO:0048021 regulation of melanin biosynthetic process Biological Process

GO:0048731 system development Biological Process

KEGG gene cross-reference

ath:AT5G40670

bta:613527

ddi:DDB_G0279445

hsa:1497

mmu:83429

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.453

Rank 1 · LXL04_006080 · OH-1004

Cytoplasm0.248

Rank 2 · LXL04_006080 · OH-1004

Cell membrane0.219

Rank 3 · LXL04_006080 · OH-1004

Golgi apparatus0.173

Rank 4 · LXL04_006080 · OH-1004

Endoplasmic reticulum0.130

Rank 5 · LXL04_006080 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04193.20PQ-loop12-68 aa

PF04193.20PQ-loop152-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006080	`PF04193.20`	PQ-loop	12	68	5.9e-32	109.9
LXL04_006080	`PF04193.20`	PQ-loop	152	208	5.9e-32	109.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P57758`	Arabidopsis thaliana	Cystinosin homolog	66.791%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card